Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-Q0GMU2

Uncultured bacterium clone pUE5 esterase/lipase (estE5)

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
13 structures (e.g. : 3FAK, 3G9T, 3G9U... more)
No kinetic





1 substrate:
Paranitrophenyl-octanoate
1 inhbitor:
PMSF
1 Genbank : DQ842023
1 UniProt : Q0GMU2
>3 Structure links 10 more: 3L1H, 3L1I, 3L1J
1 UniProt : Q0GMU2
1 Interpro : Q0GMU2
1 Prodom : Q0GMU2
1 Pfam : Q0GMU2
1 PIRSF : Q0GMU2
1 SUPERFAM : Q0GMU2
Sequence
Graphical view for this peptide sequence: 9bact-Q0GMU2
Colored MSA for Hormone-sensitive_lipase_like (raw)
MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVT
VAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAA
ALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLV
LAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGIN
KMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAK
AKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAGPEIVKLKKILREKAVPPGTEVPLDVMRKGMEKVAFKAADDIQVEQVT
VAGCAAEWVRAPGCQAGKAILYLHGGGYVMGSINTHRSMVGEISRASQAA
ALLLDYRLAPEHPFPAAVEDGVAAYRWLLDQGFKPQHLSISGDSAGGGLV
LAVLVSARDQGLPMPASAIPISPWADMTCTNDSFKTRAEADPMVAPGGIN
KMAARYLNGADAKHPYASPNFANLKGLPPLLIHVGRDEVLLDDSIKLDAK
AKADGVKSTLEIWDDMIHVWHAFHPMLPEGKQAIVRVGEFMREQWAA


References
    Title: Structural and functional analysis of a novel EstE5 belonging to the subfamily of hormone-sensitive lipase
    Nam KH, Kim MY, Kim SJ, Priyadarshi A, Lee WH, Hwang KY
    Ref: Biochemical & Biophysical Research Communications, 379:553, 2009 : PubMed

            

    Title: The crystal structure of an HSL-homolog EstE5 complex with PMSF reveals a unique configuration that inhibits the nucleophile Ser144 in catalytic triads
    Nam KH, Kim SJ, Priyadarshi A, Kim HS, Hwang KY
    Ref: Biochemical & Biophysical Research Communications, 389:247, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer