Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a142j6i6

uncultured bacterium esterase PMGL2 with GCSAG motif from a permafrost metagenomic library.

Relationship
Family|GTSAGmotif
Block| H
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
3 structures: 6QIN, 6QLA, 6ZL7
No kinetic





No Substrate
No inhibitor
1 Genbank : AMR72657
1 UniProt : A0A142J6I6
3 Structure : 6ZL7, 6QLA, 6QIN
1 UniProt : A0A142J6I6
1 Interpro : A0A142J6I6
1 Prodom : A0A142J6I6
1 Pfam : A0A142J6I6
1 PIRSF : A0A142J6I6
1 SUPERFAM : A0A142J6I6
Sequence
Graphical view for this peptide sequence: 9bact-a0a142j6i6
Colored MSA for GTSAGmotif (raw)
MASGSASSAQTPGLMSWLPPSNQLSPEARSVLDRMDAAKAPEFNGDLVRQ
RAFYQQFNDDRLVEMRRVFRTRERHETLNAVHVQVVEPADGVSARNRDRV
LINVHGGAFMWGAGSGALVEAIPIAATMGVSVVTVDYRLAPENRYPAASE
DVTAVYRALLERYPAANIGIFGCSAGGVITAQAVTWIRREGLPRPGAIGT
LCGTGAPYSGDSPYLAGVVPVGPGVKAPPLPGLLPTAYMEGVGADDARAY
PLTSDAETVFMPPTLLLAGGRDFAVSALSLAHRRLARAGVDSELHLFDGL
PHAFFVWPDMPESLEAYALIAGFFDSRLGLTPSSSIPTPRSPS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASGSASSAQTPGLMSWLPPSNQLSPEARSVLDRMDAAKAPEFNGDLVRQ
RAFYQQFNDDRLVEMRRVFRTRERHETLNAVHVQVVEPADGVSARNRDRV
LINVHGGAFMWGAGSGALVEAIPIAATMGVSVVTVDYRLAPENRYPAASE
DVTAVYRALLERYPAANIGIFGCSAGGVITAQAVTWIRREGLPRPGAIGT
LCGTGAPYSGDSPYLAGVVPVGPGVKAPPLPGLLPTAYMEGVGADDARAY
PLTSDAETVFMPPTLLLAGGRDFAVSALSLAHRRLARAGVDSELHLFDGL
PHAFFVWPDMPESLEAYALIAGFFDSRLGLTPSSSIPTPRSPS


References
2 more
    Title: Crystal structure of PMGL2 esterase from the hormone-sensitive lipase family with GCSAG motif around the catalytic serine
    Boyko KM, Kryukova MV, Petrovskaya LE, Nikolaeva AY, Korzhenevsky DA, Novototskaya-Vlasova KA, Rivkina EM, Dolgikh DA, Kirpichnikov MP, Popov VO
    Ref: PLoS ONE, 15:e0226838, 2020 : PubMed

            

    Title: Effect of Cysteine Residue Substitution in the GCSAG Motif of the PMGL2 Esterase Active Site on the Enzyme Properties
    Kryukova MV, Petrovskaya LE, Novototskaya-Vlasova KA, Kryukova EA, Yakimov SA, Nikolaeva AY, Boyko KM, Dolgikh DA, Kirpichnikov MP
    Ref: Biochemistry (Mosc), 85:709, 2020 : PubMed

            

    Title: Expression and characterization of a new esterase with GCSAG motif from a permafrost metagenomic library
    Petrovskaya LE, Novototskaya-Vlasova KA, Spirina EV, Durdenko EV, Lomakina GY, Zavialova MG, Nikolaev EN, Rivkina EM
    Ref: FEMS Microbiol Ecol, 92:, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer