Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a1b1h1k0

uncultured bacterium; Alteromonas macleodii; Alteromonas marina, Homoserine O-acetyltransferase Est22 esterase not transferase

Comment
Other strains: Alteromonas macleodii (Pseudoalteromonas macleodii)( English Channel 673; Black Sea 11; Balearic Sea AD45); Alteromonas marina


Relationship
Family|Homoserine_transacetylase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 5JKF, 5JKJ
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9bact-a0a1b1h1k0
Colored MSA for Homoserine_transacetylase (raw)
SSSKAPSSEAPSSSSSASRSNASLMVEKRVFEMPHFTTFGGKQIKNVKVG
WEAYGTLNDAKSNVILITHYFSGSSHAAGKYDENDPAPGYWDSIIGPGKA
IDTDRFYVISVDTLANLNAYDPHVITTGPTSINPDTGKPYGLDFPVVTIR
DFVNVQKALLESLGISKLYAVIGPSMGSMQAIDWASAYPGWVERMISVIG
AGQSDAWTTAALEHWATPITLDKNWNNGAYSKEQAPLNGLAASLMLITQN
ALTPSFFNQTGNTLGYKNVESAPLNDIRQSHSIVNWLRERAKTRAKSMDA
NHLLYLVRACQLFVAGHQGNLEQGLASIKAKTLFIPAQTDLLLMPYLSQS
AHQGLTSMNNDSTLVTLNGKLGHLEGVTNVSAQAQAIRQFLENDKAAMQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

SSSKAPSSEAPSSSSSASRSNASLMVEKRVFEMPHFTTFGGKQIKNVKVG
WEAYGTLNDAKSNVILITHYFSGSSHAAGKYDENDPAPGYWDSIIGPGKA
IDTDRFYVISVDTLANLNAYDPHVITTGPTSINPDTGKPYGLDFPVVTIR
DFVNVQKALLESLGISKLYAVIGPSMGSMQAIDWASAYPGWVERMISVIG
AGQSDAWTTAALEHWATPITLDKNWNNGAYSKEQAPLNGLAASLMLITQN
ALTPSFFNQTGNTLGYKNVESAPLNDIRQSHSIVNWLRERAKTRAKSMDA
NHLLYLVRACQLFVAGHQGNLEQGLASIKAKTLFIPAQTDLLLMPYLSQS
AHQGLTSMNNDSTLVTLNGKLGHLEGVTNVSAQAQAIRQFLENDKAAMQ


Reference
    Title: A Novel Subfamily Esterase with a Homoserine Transacetylase-like Fold but no Transferase Activity
    Li PY, Yao QQ, Wang P, Zhang Y, Li Y, Zhang YQ, Hao J, Zhou BC, Chen XL and Zhang XY <2 more author(s)>
    Ref: Applied Environmental Microbiology, 83:e00131"", 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer