Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a1f6kk86

Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_39_10. Uncharacterized protein

Relationship
Family|Prolyl_oligopeptidase_S9
Block| X
Position in NCBI Life Tree|Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_39_10
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria: N E > Bacteria candidate phyla: N E > Patescibacteria group: N E > Microgenomates group: N E > Candidatus Levybacteria: N E > Candidatus Levybacteria bacterium RIFCSPLOWO2_01_FULL_39_10: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : MFOV01000017
1 UniProt : A0A1F6KK86
1 UniProt : A0A1F6KK86
1 Interpro : A0A1F6KK86
1 Pfam : A0A1F6KK86
1 PIRSF : A0A1F6KK86
1 SUPERFAM : A0A1F6KK86
Sequence
Graphical view for this peptide sequence: 9bact-a0a1f6kk86
Colored MSA for Prolyl_oligopeptidase_S9 (raw)
MKKILGLICIVLLFVVALESLYIFQNQWFRKNIIEEISIIKRPLLSYTFE
NLKKTKFPKNQITFGPVISEDDDSFSQVFYFSVPKAPGENEMEKVSGLAT
IPKEEGEYPVIVMFHGFIPDDIYEPGAGTKPTASQLSKNGFITLAPDFLG
FGDSASPSAVHFEGRFQTYTTALTLLSSLITLNQGLEKDYVGTVSADLEK
IGLWGHSNGGHIALSTLAISGEAYPTVLWAPVSKSFPYSILYYTDEYDDQ
GKGMRKSLSHFEEIYDTDLFSPAKYYNLIKAPIQIHQGTGDEEVPYWWTD
ELVEILEENAQDVTYFQYPGANHNLFPSDWSEAVTNTIEFYKQGFSL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKILGLICIVLLFVVALESLYIFQNQWFRKNIIEEISIIKRPLLSYTFE
NLKKTKFPKNQITFGPVISEDDDSFSQVFYFSVPKAPGENEMEKVSGLAT
IPKEEGEYPVIVMFHGFIPDDIYEPGAGTKPTASQLSKNGFITLAPDFLG
FGDSASPSAVHFEGRFQTYTTALTLLSSLITLNQGLEKDYVGTVSADLEK
IGLWGHSNGGHIALSTLAISGEAYPTVLWAPVSKSFPYSILYYTDEYDDQ
GKGMRKSLSHFEEIYDTDLFSPAKYYNLIKAPIQIHQGTGDEEVPYWWTD
ELVEILEENAQDVTYFQYPGANHNLFPSDWSEAVTNTIEFYKQGFSL


Reference
    Title: Thousands of microbial genomes shed light on interconnected biogeochemical processes in an aquifer system
    Anantharaman K, Brown CT, Hug LA, Sharon I, Castelle CJ, Probst AJ, Thomas BC, Singh A, Wilkins MJ and Banfield JF <4 more author(s)>
    Ref: Nat Commun, 7:13219, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer