Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a1s5qm38

uncultured bacterium, EH26,clone MGS-ElMaxE1 Alpha/beta hydrolase fold carboxyl esterase

Comment
EH26 promiscuous activity 32/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : KR107266, AMK51981
1 UniProt : A0A1S5QM38
1 UniProt : A0A1S5QM38
1 Interpro : A0A1S5QM38
1 Prodom : A0A1S5QM38
1 Pfam : A0A1S5QM38
1 PIRSF : A0A1S5QM38
1 SUPERFAM : A0A1S5QM38
Sequence
Graphical view for this peptide sequence: 9bact-a0a1s5qm38
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MKKQLLVLLIPFLLLAGCATGPSALRHDVAVSYDAERIAYDVAGEGETAL
IFVHGWSCDGRYWQEQVPVFAKDYRVITVDLAGHGHSSLERSDYSMLSFA
QDVKAVMDRENIGRAVLIGHSMGGGVIAEAARLMPKRVVGIVGVDTLQNV
GELTPESVIEEMVTPFESDFRTATQGFVSQMFPAGTDQQLMDWVKEDMSS
APKVPALSAFRNYLGQYVSGDAAAVFKDVSVPVVSINARLWPTAFEENQK
HIKDYQLLYIEESGHFPMLERPDAFNALLQQAIEAIETRNGI
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKQLLVLLIPFLLLAGCATGPSALRHDVAVSYDAERIAYDVAGEGETAL
IFVHGWSCDGRYWQEQVPVFAKDYRVITVDLAGHGHSSLERSDYSMLSFA
QDVKAVMDRENIGRAVLIGHSMGGGVIAEAARLMPKRVVGIVGVDTLQNV
GELTPESVIEEMVTPFESDFRTATQGFVSQMFPAGTDQQLMDWVKEDMSS
APKVPALSAFRNYLGQYVSGDAAAVFKDVSVPVVSINARLWPTAFEENQK
HIKDYQLLYIEESGHFPMLERPDAFNALLQQAIEAIETRNGI


Reference
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer