Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a1u9wz58

uncultured bacterium Sibe-eh Alpha/beta epoxide hydrolase

Comment
Sibe-eh Novel epoxide hydrolase belonging to the alpha/beta hydrolases superfamily in metagenomes from ORF found in the Russian metagenome hot environments


Relationship
Family|Epoxide_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5NFQ: Novel epoxide hydrolases belonging to the alpha/beta hydrolases superfamily in metagenomes from hot environments
No kinetic





6 substrates (e.g. : Cyclohexene-oxide, Cyclopentene-oxide, Epoxyhexane... more)
No inhibitor
1 Genbank : AQY61767
1 UniProt : A0A1U9WZ58
1 Structure : 5NFQ
1 UniProt : A0A1U9WZ58
1 Interpro : A0A1U9WZ58
1 Pfam : A0A1U9WZ58
1 PIRSF : A0A1U9WZ58
1 SUPERFAM : A0A1U9WZ58
Sequence
Graphical view for this peptide sequence: 9bact-a0a1u9wz58
Colored MSA for Epoxide_hydrolase (raw)
MTFELKRVALPNGIHLDVVDEGPTDAPVLIFLHGFPESHRTWRHQIRHFS
DRFRCIAPDQRGYRGSSKPQEVAAYTPDKLIGDIFLLADTLGIGSFTIVG
HDWGGAIAWGVALGGQHLRVERAIIANAPHPAIFQKLLYTHPVQREASQY
IRGFRDPANDALVKEHGLTGLLMKEVKWDRPSAMEPEERDQLLRDWQNHD
AAFGMLNYYRASPIDVPTMDAPFKVPAGYTPPQLPRLTIPTLVIWALDDL
ALPPENLEGLEEIIDPLTIVRVPDCGHFVPWEAPDAVNAAMEGFLAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTFELKRVALPNGIHLDVVDEGPTDAPVLIFLHGFPESHRTWRHQIRHFS
DRFRCIAPDQRGYRGSSKPQEVAAYTPDKLIGDIFLLADTLGIGSFTIVG
HDWGGAIAWGVALGGQHLRVERAIIANAPHPAIFQKLLYTHPVQREASQY
IRGFRDPANDALVKEHGLTGLLMKEVKWDRPSAMEPEERDQLLRDWQNHD
AAFGMLNYYRASPIDVPTMDAPFKVPAGYTPPQLPRLTIPTLVIWALDDL
ALPPENLEGLEEIIDPLTIVRVPDCGHFVPWEAPDAVNAAMEGFLAG


Reference
    Title: New Thermophilic alpha/beta Class Epoxide Hydrolases Found in Metagenomes From Hot Environments
    Ferrandi EE, Sayer C, De Rose SA, Guazzelli E, Marchesi C, Saneei V, Isupov MN, Littlechild JA, Monti D
    Ref: Front Bioeng Biotechnol, 6:144, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer