9bact-a0a2h5z9r5

 
Enterobacter sp. bacterium HR29 Poly(Ethylene terephthalate) hydrolase Bis(2-hydroxyethyl) terephthalate ester esterase BhrPETase Bomgl monoacylglycerol lipase

Relationship
Block L
bacterium HR29 position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria (miscellaneous): N E > bacterium HR29: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7EOA: Structure of Bomgl, a monoacylglycerol lipase from marine Bacillus: HR-PETase from Bacterium HR29
No kinetic



1 Genbank : GBD22443
1 UniProt : A0A2H5Z9R5
1 Structure : 7EOA
1 UniProtTrembl : A0A2H5Z9R5
1 Interpro : A0A2H5Z9R5
1 Prodom : A0A2H5Z9R5
1 Pfam : A0A2H5Z9R5
1 PIRSF : A0A2H5Z9R5
1 SUPERFAM : A0A2H5Z9R5
1 QuickSwissBlast : A0A2H5Z9R5
 
Sequence
Graphical view for this peptide sequence: 9bact-a0a2h5z9r5
Colored MSA for Polyesterase-lipase-cutinase (raw)
MQVVLGRVRSAGLLAALLALAAWALVWASPSAEAQSNPYQRGPNPTRSAL
TTDGPFSVATYSVSRLSVSGFGGGVIYYPTGTTLTFGGIAMSPGYTADAS
SLAWLGRRLASHGFVVIVINTNSRLDFPDSRASQLSAALNYLRTSSPSAV
RARLDANRLAVAGHSMGGGATLRISEQIPTLKAGVPLTPWHTDKTFNTPV
PQLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNATHFAPNSPNA
AISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRSNNRHCQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MQVVLGRVRSAGLLAALLALAAWALVWASPSAEAQSNPYQRGPNPTRSAL
TTDGPFSVATYSVSRLSVSGFGGGVIYYPTGTTLTFGGIAMSPGYTADAS
SLAWLGRRLASHGFVVIVINTNSRLDFPDSRASQLSAALNYLRTSSPSAV
RARLDANRLAVAGHSMGGGATLRISEQIPTLKAGVPLTPWHTDKTFNTPV
PQLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNATHFAPNSPNA
AISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRSNNRHCQ

no DNA




References
    Title: Perspectives on the Role of Enzymatic Biocatalysis for the Degradation of Plastic PET
    Magalhaes RP, Cunha JM, Sousa SF
    Ref: Int J Mol Sci, 22:11257, 2021 : PubMed

            

    Title: Secretory expression in Bacillus subtilis and biochemical characterization of a highly thermostable polyethylene terephthalate hydrolase from bacterium HR29
    Xi X, Ni K, Hao H, Shang Y, Zhao B, Qian Z
    Ref: Enzyme Microb Technol, 143:109715, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer