Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a0a2s1gux0

esterase fromdeep-sea hydrothermal vent of the East Pacific Rise (EprEst) uncultured bacterium pet-28a est-OKK esterase

Relationship
Family|ABHD11-Acetyl_transferase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
7C4D: Structure of an esterase from the deep-sea hydrothermal vent of the East Pacific Rise (EprEst)
No kinetic





2 substrates: Paranitrophenyl-hexanoate, Paranitrophenylbutyrate
No inhibitor
2 Genbank : MF277135, AWD93592
1 UniProt : A0A2S1GUX0
1 Structure : 7C4D
1 UniProt : A0A2S1GUX0
1 Interpro : A0A2S1GUX0
1 Prodom : A0A2S1GUX0
1 Pfam : A0A2S1GUX0
1 PIRSF : A0A2S1GUX0
1 SUPERFAM : A0A2S1GUX0
Sequence
Graphical view for this peptide sequence: 9bact-a0a2s1gux0
Colored MSA for ABHD11-Acetyl_transferase (raw)
MLELFFRKKGESGEPLIILHGLYGSGDNWISIANELKDYFQVYLIDQRNH
GRSPHADDMSYESMAEDLHEFIKSQNLESVNIIGHSMGGKTAMWFTAAHP
DKVKKLIVADIAPGKYDTTSPNVKTHKKIIAALKSIDPSEAKTRKEIETQ
LSRYIDNVQLRMFLLKNIERKEDGCYRWKINIDSIEKNIINIMSGITGID
IPVHVPALFLKGELSDYITDKDIPLIKEIFPDAKLVTIPGAGHWLHAQQP
KIFIQKTLEFLRNRKTVDR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLELFFRKKGESGEPLIILHGLYGSGDNWISIANELKDYFQVYLIDQRNH
GRSPHADDMSYESMAEDLHEFIKSQNLESVNIIGHSMGGKTAMWFTAAHP
DKVKKLIVADIAPGKYDTTSPNVKTHKKIIAALKSIDPSEAKTRKEIETQ
LSRYIDNVQLRMFLLKNIERKEDGCYRWKINIDSIEKNIINIMSGITGID
IPVHVPALFLKGELSDYITDKDIPLIKEIFPDAKLVTIPGAGHWLHAQQP
KIFIQKTLEFLRNRKTVDR


References
    Title: Structural Insights into a Novel Esterase from the East Pacific Rise and Its Improved Thermostability by a Semirational Design
    Zhu C, Chen Y, Isupov MN, Littlechild JA, Sun L, Liu X, Wang Q, Gong H, Dong P and Wu Y <1 more author(s)>
    Ref: Journal of Agricultural and Food Chemistry, :, 2021 : PubMed

            

    Title: Identification and characterization of a novel alkalistable and salt-tolerant esterase from the deep-sea hydrothermal vent of the East Pacific Rise
    Yang X, Wu L, Xu Y, Ke C, Hu F, Xiao X, Huang J
    Ref: Microbiologyopen, 7:e00601, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer