Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-a4uz10

uncultured bacterium PLA depolymerase pLA-M4 pLAM4

Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : A4UZ10
1 UniProt : A4UZ10
1 UniProt : A4UZ10
1 Interpro : A4UZ10
1 Prodom : A4UZ10
1 Pfam : A4UZ10
1 PIRSF : A4UZ10
1 SUPERFAM : A4UZ10
Sequence
Graphical view for this peptide sequence: 9bact-a4uz10
Colored MSA for Bacterial_lip_FamI.5 (raw)
MLLKKRWLIFISFLLAFTLLIPTAASASEKHYKPNIALEPIENSEGNEHP
IILVHGLGGFGRDELGGIIKMWGGIHDIEKKLREKGYKVYTAAVGPVSSN
RDRAIELYYQIKGGTVDYGEAHAKKYGHDRYGRTYPGFYPEWGEINPKTG
KPNKVHLIGHSMGGQTIRTLAQLLYEGDPEEHKTGGNDISPLLSGEKQPW
LHSVLSISSPHDGSTATYLVNDVIPIIQELVIGAAIFAGNIDQNLYDFKL
DHWGIKKRPGESFHSYVQRVRNSPGWKTKDTANWDLKPEGAYELNRWVKA
QPDVYYFSVSNTQSRRSLLTGYYVPDLFMNPFLHPTAYYIGSKTFRKSNF
VLDKTWWENDGLVSVKAMKGPNIGSNDVIVEYNGTPRKGVWNHLGTMRQF
DHLDIIGWGVRDVTSWYEDVARFLYSLPDDY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLLKKRWLIFISFLLAFTLLIPTAASASEKHYKPNIALEPIENSEGNEHP
IILVHGLGGFGRDELGGIIKMWGGIHDIEKKLREKGYKVYTAAVGPVSSN
RDRAIELYYQIKGGTVDYGEAHAKKYGHDRYGRTYPGFYPEWGEINPKTG
KPNKVHLIGHSMGGQTIRTLAQLLYEGDPEEHKTGGNDISPLLSGEKQPW
LHSVLSISSPHDGSTATYLVNDVIPIIQELVIGAAIFAGNIDQNLYDFKL
DHWGIKKRPGESFHSYVQRVRNSPGWKTKDTANWDLKPEGAYELNRWVKA
QPDVYYFSVSNTQSRRSLLTGYYVPDLFMNPFLHPTAYYIGSKTFRKSNF
VLDKTWWENDGLVSVKAMKGPNIGSNDVIVEYNGTPRKGVWNHLGTMRQF
DHLDIIGWGVRDVTSWYEDVARFLYSLPDDY


References
    Title: Screening and Characterization of Novel Polyesterases from Environmental Metagenomes with High Hydrolytic Activity against Synthetic Polyesters
    Hajighasemi M, Tchigvintsev A, Nocek B, Flick R, Popovic A, Hai T, Khusnutdinova AN, Brown G, Xu X and Yakunin AF <11 more author(s)>
    Ref: Environ Sci Technol, 52:12388, 2018 : PubMed

            

    Title: Identification and characterization of novel poly(DL-lactic acid) depolymerases from metagenome
    Mayumi D, Akutsu-Shigeno Y, Uchiyama H, Nomura N, Nakajima-kambe T
    Ref: Applied Microbiology & Biotechnology, 79:743, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer