Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-c3ryl0

uncultured bacterium Polyethylene terephthalate hydrolyzing lipase PET2 LipIAF5-2

Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
2 structures: 7EC8, 7ECB
No kinetic





1 substrate:
Polyethylene-terephthalate
No inhibitor
1 Genbank : ACC95208
1 UniProt : C3RYL0
2 Structure : 7ECB, 7EC8
1 UniProt : C3RYL0
1 Interpro : C3RYL0
1 Prodom : C3RYL0
1 Pfam : C3RYL0
1 PIRSF : C3RYL0
1 SUPERFAM : C3RYL0
Sequence
Graphical view for this peptide sequence: 9bact-c3ryl0
Colored MSA for Polyesterase-lipase-cutinase (raw)
MPITARNTLASLLLASSALLLSGTAFAANPPGGDPDPGCQTDCNYQRGPD
PTDAYLEAASGPYTVSTIRVSSLVPGFGGGTIHYPTNAGGGKMAGIVVIP
GYLSFESSIEWWGPRLASHGFVVMTIDTNTIYDQPSQRRDQIEAALQYLV
NQSNSSSSPISGMVDSSRLAAVGWSMGGGGTLQLAADGGIKAAIALAPWN
SSINDFNRIQVPTLIFACQLDAIAPVALHASPFYNRIPNTTPKAFFEMTG
GDHWCANGGNIYSALLGKYGVSWMKLHLDQDTRYAPFLCGPNHAAQTLIS
EYRGNCPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPITARNTLASLLLASSALLLSGTAFAANPPGGDPDPGCQTDCNYQRGPD
PTDAYLEAASGPYTVSTIRVSSLVPGFGGGTIHYPTNAGGGKMAGIVVIP
GYLSFESSIEWWGPRLASHGFVVMTIDTNTIYDQPSQRRDQIEAALQYLV
NQSNSSSSPISGMVDSSRLAAVGWSMGGGGTLQLAADGGIKAAIALAPWN
SSINDFNRIQVPTLIFACQLDAIAPVALHASPFYNRIPNTTPKAFFEMTG
GDHWCANGGNIYSALLGKYGVSWMKLHLDQDTRYAPFLCGPNHAAQTLIS
EYRGNCPY


References
    Title: Positive Charge Introduction on the Surface of Thermostabilized PET Hydrolase Facilitates PET Binding and Degradation
    Nakamura A, Kobayashi N, Koga N, Iino R
    Ref: ACS Catal, 11:8550, 2021 : PubMed

            

    Title: New insights into the function and global distribution of polyethylene terephthalate (PET) degrading bacteria and enzymes in marine and terrestrial metagenomes
    Danso D, Schmeisser C, Chow J, Zimmermann W, Wei R, Leggewie C, Li X, Hazen T, Streit WR
    Ref: Applied Environmental Microbiology, 84:e2773, 2018 : PubMed

            

    Title: Isolation and characterization of a new alkali-thermostable lipase cloned from a metagenomic library
    Meilleur C, Hupe JF, Juteau P, Shareck F
    Ref: J Ind Microbiol Biotechnol, 36:853, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer