9bact-g9by57

 
Uncultured bacteria cutinase homolog from leaf-branch compost metagenomic. Leaf and branch compost cutinase (LCC) PETH_UNKP

Relationship
Block L
uncultured bacteria position in NCBI Life Tree :
N link to NCBI taxonomic web page and E link to ESTHER gene locus found in this strain.
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
9 structures (e.g. : 7VVC, 7VVE, 7W1N... more)
No kinetic

Substrate: Polyethylene-terephthalate , Polycaprolactone ,

2 Genbank : HQ704839, AEV21261
1 UniProt : G9BY57
>3 Structure links 6 more: 7VVC, 7VVE, 7W1N
1 UniProtTrembl : G9BY57
1 Interpro : G9BY57
1 Prodom : G9BY57
1 Pfam : G9BY57
1 PIRSF : G9BY57
1 SUPERFAM : G9BY57
1 QuickSwissBlast : G9BY57
 
Sequence
Graphical view for this peptide sequence: 9bact-g9by57
Colored MSA for Polyesterase-lipase-cutinase (raw)
MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSAL
TADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADAS
SLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAV
RARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSV
PVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNA
AISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MDGVLWRVRTAALMAALLALAAWALVWASPSVEAQSNPYQRGPNPTRSAL
TADGPFSVATYTVSRLSVSGFGGGVIYYPTGTSLTFGGIAMSPGYTADAS
SLAWLGRRLASHGFVVLVINTNSRFDYPDSRASQLSAALNYLRTSSPSAV
RARLDANRLAVAGHSMGGGGTLRIAEQNPSLKAAVPLTPWHTDKTFNTSV
PVLIVGAEADTVAPVSQHAIPFYQNLPSTTPKVYVELDNASHFAPNSNNA
AISVYTISWMKLWVDNDTRYRQFLCNVNDPALSDFRTNNRHCQ

no DNA




References
12 more
    Title: An NMR look at an engineered PET depolymerase
    Charlier C, Gavalda S, Borsenberger V, Duquesne S, Marty A, Tournier V, Lippens G
    Ref: Biophysical Journal, :, 2022 : PubMed

            

    Title: Real-Time Noninvasive Analysis of Biocatalytic PET Degradation
    Frank R, Krinke D, Sonnendecker C, Zimmermann W, Jahnke HG
    Ref: ACS Catal, 12:25, 2022 : PubMed

            

    Title: Substrate-Binding Mode of a Thermophilic PET Hydrolase and Engineering the Enzyme to Enhance the Hydrolytic Efficacy
    Zeng W, Li X, Yang Y, Min J, Huang JW, Liu W, Niu D, Yang X, Han X and Guo RT <3 more author(s)>
    Ref: ACS Catal, 12:3033, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer