Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-i6yrg4

uncultured bacterium Est816 N-Acyl homoserine lactone degrading enzyme

Relationship
Family|6_AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
1 structure:
5EGN: Est816 as an N-Acyl homoserine lactone degrading enzyme
No kinetic





No Substrate
No inhibitor
1 Genbank : AFN73127
1 UniProt : I6YRG4
1 Structure : 5EGN
1 UniProt : I6YRG4
1 Interpro : I6YRG4
1 Prodom : I6YRG4
1 Pfam : I6YRG4
1 PIRSF : I6YRG4
1 SUPERFAM : I6YRG4
Sequence
Graphical view for this peptide sequence: 9bact-i6yrg4
Colored MSA for 6_AlphaBeta_hydrolase (raw)
MPHVENDGVKIYYDSYGEGVPIVFLHPFSTNGGIWYFQTFPFAQTNHVIV
IDHRGHGRSDKPATGYSIMEHADDVVAVLDALKVDRAVFVGNSIGGMIAM
QLNLDHPQRVIGNLILSSGTGLGEGMPPEAGAAFQNDYIGAFGGLLEGAV
SARSKRERPEILAVMKAHFSVPSNFPKHVFDAATADPNGVFAWNIKDRLS
SIQAPTLVVAGEEDLATTVANNQLLADNIPGAELRVIKDVGHFYQLERPS
EFNELLRGFVARVAREASLVS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPHVENDGVKIYYDSYGEGVPIVFLHPFSTNGGIWYFQTFPFAQTNHVIV
IDHRGHGRSDKPATGYSIMEHADDVVAVLDALKVDRAVFVGNSIGGMIAM
QLNLDHPQRVIGNLILSSGTGLGEGMPPEAGAAFQNDYIGAFGGLLEGAV
SARSKRERPEILAVMKAHFSVPSNFPKHVFDAATADPNGVFAWNIKDRLS
SIQAPTLVVAGEEDLATTVANNQLLADNIPGAELRVIKDVGHFYQLERPS
EFNELLRGFVARVAREASLVS


References
    Title: Reshaping the active pocket of esterase Est816 for resolution of economically important racemates
    Liu X, Zhao M, Fan XJ, Fu Y
    Ref: Catal Sci Technol, :, 2021 : PubMed

            

    Title: Engineering of a thermostable esterase Est816 to improve its quorum-quenching activity and the underlying structural basis
    Liu X, Cao LC, Fan XJ, Liu YH, Xie W
    Ref: Sci Rep, 6:38137, 2016 : PubMed

            

    Title: The cloning and characterization of one novel metagenome-derived thermostable esterase acting on N-acylhomoserine lactones
    Fan X, Liu X, Liu Y
    Ref: J Mol Catal B Enzym, 83:29, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer