Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q3ymm2

uncultured bacterium Lipase/esterase

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : DQ077747
1 UniProt : Q3YMM2
1 UniProt : Q3YMM2
1 Interpro : Q3YMM2
1 Pfam : Q3YMM2
1 PIRSF : Q3YMM2
1 SUPERFAM : Q3YMM2
Sequence
Graphical view for this peptide sequence: 9bact-q3ymm2
Colored MSA for abh_upf0017 (raw)
MLPLRPYQPPFWLFNGHLQTLWPVWKTLRLPPIAWPRERWETPDGDFIDV
DCVNTGTQEAPILVLFHGLEGNAQSHYARTMATRLQDIGWTGFVPHFRGC
SGTLNRLPRAYHSGDSAEIDWILRRFRSRYPGRPICAAGVSLGGNALMKW
LGEQGAAAGKVINAAAAISPPMDVAACGAWLDQGANRRVYTQHFLRTMKQ
QAEARLQQFPGLFDAARMRTASTLREFDDTVTAPLHGFSGVDDYWRRASA
LPLLHDIDLPTLLLMPLNDPFLADACYPAPAQCPLMVTLETPAAGGHVGF
SNHRGDHQDLWLPTRIINFFAQSLGLPLSTRAPH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLPLRPYQPPFWLFNGHLQTLWPVWKTLRLPPIAWPRERWETPDGDFIDV
DCVNTGTQEAPILVLFHGLEGNAQSHYARTMATRLQDIGWTGFVPHFRGC
SGTLNRLPRAYHSGDSAEIDWILRRFRSRYPGRPICAAGVSLGGNALMKW
LGEQGAAAGKVINAAAAISPPMDVAACGAWLDQGANRRVYTQHFLRTMKQ
QAEARLQQFPGLFDAARMRTASTLREFDDTVTAPLHGFSGVDDYWRRASA
LPLLHDIDLPTLLLMPLNDPFLADACYPAPAQCPLMVTLETPAAGGHVGF
SNHRGDHQDLWLPTRIINFFAQSLGLPLSTRAPH


Reference
    Title: Isolation of novel lipolytic genes from uncultured bacteria of pond water
    Ranjan R, Grover A, Kapardar RK, Sharma R
    Ref: Biochemical & Biophysical Research Communications, 335:57, 2005 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer