Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q6sh76

uncultured bacterium 442 and marine gamma proteobacterium HTCC2080 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (EC 3.7.1.-)

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|marine gamma proteobacterium HTCC2080
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Gammaproteobacteria: N E > Cellvibrionales: N E > Halieaceae: N E > unclassified Halieaceae: N E > marine gamma proteobacterium HTCC2080: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AY458639, AAVV01000005
2 UniProt : Q6SH76, A0Z4P6
2 UniProt : Q6SH76, A0Z4P6
2 Interpro : Q6SH76, A0Z4P6
2 Prodom : Q6SH76, A0Z4P6
2 Pfam : Q6SH76, A0Z4P6
2 PIRSF : Q6SH76, A0Z4P6
2 SUPERFAM : Q6SH76, A0Z4P6
Sequence
Graphical view for this peptide sequence: 9bact-q6sh76
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MSSNTAAPQFLTTPEGLSLHYTDHPATGEEQGTLVFIHGSGPGASGWSNF
KHNIAAFQMADYRCVVYDQWGYGKTDKPTHIDHTLDFFVDGLGALLDGLA
LQSVTLVGNSLGGAVALGMALRQPERVKQLILMAPGGIESREDYFAMEGI
QTMVKYPMGSPEFTRDVLAKLLTLLVYDEASIDEELIEERWTTLQTQNSH
VLATMAIPDLSDQIGHIAQPMLIFWGTEDKFCPASGVWKMLKGGGQVQAE
ILNQCGHWVMTEHPELFNTRSLAFLSTSASH
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSNTAAPQFLTTPEGLSLHYTDHPATGEEQGTLVFIHGSGPGASGWSNF
KHNIAAFQMADYRCVVYDQWGYGKTDKPTHIDHTLDFFVDGLGALLDGLA
LQSVTLVGNSLGGAVALGMALRQPERVKQLILMAPGGIESREDYFAMEGI
QTMVKYPMGSPEFTRDVLAKLLTLLVYDEASIDEELIEERWTTLQTQNSH
VLATMAIPDLSDQIGHIAQPMLIFWGTEDKFCPASGVWKMLKGGGQVQAE
ILNQCGHWVMTEHPELFNTRSLAFLSTSASH



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer