Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-q70jd5

bacterium SB2 putative oxoadipate enol-lactonase (fragment)

Relationship
Family|Carboxymethylbutenolide_lactonase
Block| X
Position in NCBI Life Tree|bacterium SB2
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > unclassified Bacteria: N E > unclassified Bacteria (miscellaneous): N E > bacterium SB2: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AJ577848
1 UniProt : Q70JD5
1 UniProt : Q70JD5
1 Interpro : Q70JD5
1 Prodom : Q70JD5
1 Pfam : Q70JD5
1 PIRSF : Q70JD5
1 SUPERFAM : Q70JD5
Sequence
Graphical view for this peptide sequence: 9bact-q70jd5
Colored MSA for Carboxymethylbutenolide_lactonase (raw)
MCMHFIELNSTTLHFSKTNSESAAPALVLINSLGTDFRIWDEFLVHLGHQ
GEVLTYDKRGHGLSSVGDERYSIDLHMRDLAALMDSQSIKNAVICGVSVG
GMIAMALQAARPDLVSGLILCDTAPRIGDAQTWQERINAIEANGMEGIAD
TVMSRWFSSGFQAKWPEAVAGYRNLLCRTPLDGYTGTCAAIRDADLTCQA
AQIDVPVLCVAGEDDQSTPPELVEEMACLIPNAKYERVGNCGHLPSLEQP
EYLAHLVRQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MCMHFIELNSTTLHFSKTNSESAAPALVLINSLGTDFRIWDEFLVHLGHQ
GEVLTYDKRGHGLSSVGDERYSIDLHMRDLAALMDSQSIKNAVICGVSVG
GMIAMALQAARPDLVSGLILCDTAPRIGDAQTWQERINAIEANGMEGIAD
TVMSRWFSSGFQAKWPEAVAGYRNLLCRTPLDGYTGTCAAIRDADLTCQA
AQIDVPVLCVAGEDDQSTPPELVEEMACLIPNAKYERVGNCGHLPSLEQP
EYLAHLVRQ


Reference
    Title: Oxygen-controlled bacterial growth in the sponge Suberites domuncula: toward a molecular understanding of the symbiotic relationships between sponge and bacteria
    Muller WE, Grebenjuk VA, Thakur NL, Thakur AN, Batel R, Krasko A, Muller IM, Breter HJ
    Ref: Applied Environmental Microbiology, 70:2332, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer