Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bact-r9qzf7

uncultured bacterium EH55 Hybrid C-C meta-cleavage hydrolase-carboxylesterase

Comment
EH55 promiscuous activity 21/96 substrates Martinez-Martinez et al. 2018


Relationship
Family|ABHD6-Lip
Block| X
Position in NCBI Life Tree|uncultured bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > environmental samples: N E > uncultured bacterium: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : JX133669, AGH13427
1 UniProt : R9QZF7
1 UniProt : R9QZF7
1 Interpro : R9QZF7
1 Prodom : R9QZF7
1 Pfam : R9QZF7
1 PIRSF : R9QZF7
1 SUPERFAM : R9QZF7
Sequence
Graphical view for this peptide sequence: 9bact-r9qzf7
Colored MSA for ABHD6-Lip (raw)
MKRFNLAQSLLGCTVFSVVLTTGCTNSQQDALYSKVIDLGRGAVNLQVEQ
AHMRDVDMTYLERKGSGPAVMLIHGFSANKDAWLKFANELPDDYHLIIPD
LAGHGETPAPINGSYDLEQQAQRLNALVAHLGLTQLHIVGNSMGGAISSI
YTTIYPEQIQSLTLMDAAGIDGANKSEYYQALENGHNPLIATDKESFENR
MQMVMEIQPFLPWPLRPAVMRDTIERVDINREIFADMIATRTRLSETNFP
ELLTEKVKVPVLIMWGEKDRVLDVSAVPVFKHYLPQAKVVLFPEVGHVPM
LEIPEKSANVLAEFIASIQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRFNLAQSLLGCTVFSVVLTTGCTNSQQDALYSKVIDLGRGAVNLQVEQ
AHMRDVDMTYLERKGSGPAVMLIHGFSANKDAWLKFANELPDDYHLIIPD
LAGHGETPAPINGSYDLEQQAQRLNALVAHLGLTQLHIVGNSMGGAISSI
YTTIYPEQIQSLTLMDAAGIDGANKSEYYQALENGHNPLIATDKESFENR
MQMVMEIQPFLPWPLRPAVMRDTIERVDINREIFADMIATRTRLSETNFP
ELLTEKVKVPVLIMWGEKDRVLDVSAVPVFKHYLPQAKVVLFPEVGHVPM
LEIPEKSANVLAEFIASIQ


References
    Title: Determinants and prediction of esterase substrate promiscuity patterns
    Martinez-Martinez M, Coscolin C, Santiago G, Chow J, Stogios PJ, Bargiela R, Gertler C, Navarro-Fernandez J, Bollinger A and Ferrer M <32 more author(s)>
    Ref: ACS Chemical Biology, 13:225, 2018 : PubMed

            

    Title: Single residues dictate the co-evolution of dual esterases: MCP hydrolases from the alpha/beta hydrolase family
    Alcaide M, Tornes J, Stogios PJ, Xu X, Gertler C, Di Leo R, Bargiela R, Lafraya A, Guazzaroni ME and Ferrer M <9 more author(s)>
    Ref: Biochemical Journal, 454:157, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer