Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bila-a0a0v0tws5

Trichinella murrelli; T. spiralis (Trichina worm); T. sp.; T. patagoniensis; T. britovi; T. pseudospiralis; T. zimbabwensis; T. nativa; T. papuae, Neuroligin

Comment
Other strains: Trichinella spiralis (Trichina worm); Trichinella murrelli; Trichinella sp. (T9;T6;T8); Trichinella patagoniensis; Trichinella britovi; Trichinella pseudospiralis; Trichinella zimbabwensis; Trichinella nativa; Trichinella papuae


Relationship
Family|Neuroligin
Block| C
Position in NCBI Life Tree|Trichinella murrelli
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Bilateria: N E > Protostomia: N E > Ecdysozoa: N E > Nematoda: N E > Enoplea: N E > Dorylaimia: N E > Trichinellida: N E > Trichinellidae: N E > Trichinella: N E > Trichinella murrelli: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
>3 Genbank links 13 more: JYDJ01000119, JYDN01000187, ABIR02001030
>3 UniProt links 15 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
>3 UniProt links 28 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
>3 Interpro links 28 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
>3 Pfam links 28 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
>3 PIRSF links 28 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
>3 SUPERFAM links 28 more: A0A0V0TWS5, A0A0V0URM6, E5SIS8
Sequence
Graphical view for this peptide sequence: 9bila-a0a0v0tws5
Colored MSA for Neuroligin (raw)
MKFLFTFFEPVHHVFIWYSSTILGTLFLITVAQPTDQDHLNLVRRHTSYG
DVLGFVHHGKLASAECYLGIPYARPPINDRRFAYPEPVDHWINLYNATYF
RPWCVQFWYSDVYLEKREQSEDCLYLNIFVPRKTVHAKPYPVLVWIHGGS
YQVGGSQLFPINGTVDNIVSHGVIFVSINYRLGPLGFLTNMRSGLFGNYG
LEDQIVALQWIKDTIGLFDGDPNRITVGGESSGAASVSILATSPRTIGLF
QRAVIRSGSAMSPWAIQSTNTDLNSAKLMEVTNCSFNDDKKTMECLRTLS
ISQMKNIWKLLADDGMKLIYSKSDSKSTNYNHPFLAHTYFTPVVDKYREN
QSIIPLPAERLIRENARLPLMIGSTTGECIAYVSWLAYLAENDRIDLCNI
EFVAPSFRFKNAEQVKQAIYQHYFDNRPIQHDTNLSHILVKIVTDQNIKV
PMMKEISYYTNKNVPIFVYSFDYSDDKLQNMHLSFAMRDQGAAHGFDLVY
LFQSMSVLDPRNITVEWASKDLNITYFIASTMTNFVKFGNPNFQTESNKL
QFHWPPFDFPSSQQMYIGSQIKPIKVPFELLYFWNRTIEIIQTLSLQHDF
IFEPPTVSNFHCGVFEDYELLNYRVAFFTVLTLSLAMLFLLGFCCFLHRN
QEKNIPTVVE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKFLFTFFEPVHHVFIWYSSTILGTLFLITVAQPTDQDHLNLVRRHTSYG
DVLGFVHHGKLASAECYLGIPYARPPINDRRFAYPEPVDHWINLYNATYF
RPWCVQFWYSDVYLEKREQSEDCLYLNIFVPRKTVHAKPYPVLVWIHGGS
YQVGGSQLFPINGTVDNIVSHGVIFVSINYRLGPLGFLTNMRSGLFGNYG
LEDQIVALQWIKDTIGLFDGDPNRITVGGESSGAASVSILATSPRTIGLF
QRAVIRSGSAMSPWAIQSTNTDLNSAKLMEVTNCSFNDDKKTMECLRTLS
ISQMKNIWKLLADDGMKLIYSKSDSKSTNYNHPFLAHTYFTPVVDKYREN
QSIIPLPAERLIRENARLPLMIGSTTGECIAYVSWLAYLAENDRIDLCNI
EFVAPSFRFKNAEQVKQAIYQHYFDNRPIQHDTNLSHILVKIVTDQNIKV
PMMKEISYYTNKNVPIFVYSFDYSDDKLQNMHLSFAMRDQGAAHGFDLVY
LFQSMSVLDPRNITVEWASKDLNITYFIASTMTNFVKFGNPNFQTESNKL
QFHWPPFDFPSSQQMYIGSQIKPIKVPFELLYFWNRTIEIIQTLSLQHDF
IFEPPTVSNFHCGVFEDYELLNYRVAFFTVLTLSLAMLFLLGFCCFLHRN
QEKNIPTVVE


Reference
    Title: The draft genome of the parasitic nematode Trichinella spiralis
    Mitreva M, Jasmer DP, Zarlenga DS, Wang Z, Abubucker S, Martin J, Taylor CM, Yin Y, Fulton L and Wilson RK <11 more author(s)>
    Ref: Nat Genet, 43:228, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer