Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bras-r0gwt8

Capsella rubella. Uncharacterized protein

Relationship
Family|Pectinacetylesterase-Notum
Block| X
Position in NCBI Life Tree|Capsella rubella
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Capsella: N E > Capsella rubella: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : KB870811
1 UniProt : R0GWT8
1 UniProt : R0GWT8
1 Interpro : R0GWT8
1 Prodom : R0GWT8
1 Pfam : R0GWT8
1 PIRSF : R0GWT8
1 SUPERFAM : R0GWT8
Sequence
Graphical view for this peptide sequence: 9bras-r0gwt8
Colored MSA for Pectinacetylesterase-Notum (raw)
MGRLTQCWSSLLVLAVVVIGTGAVPITYLQSAVAKGAVCLDGSAPAYHFD
KGFGSGVNNWIVHMEGGGWCTDVASCLARKNTMKGSSKFMNKDFGFSGIL
GGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPSNKLFFRGARVWRAV
VDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDA
GYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMKPELCFFPQY
VVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQ
LRTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQ
VANTRIATAVGNWFYGRSAFQKIDCPSPTCNPTCPAISTED
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MGRLTQCWSSLLVLAVVVIGTGAVPITYLQSAVAKGAVCLDGSAPAYHFD
KGFGSGVNNWIVHMEGGGWCTDVASCLARKNTMKGSSKFMNKDFGFSGIL
GGKQSTNPDFYNWNRIKVRYCDGSSFTGNVAAVNPSNKLFFRGARVWRAV
VDDLMAKGMKNAQNAILSGCSAGALAAILHCDTFRAILPRTARVKCVSDA
GYFIHGKDISGGSYIQSYYSKVVALHGSAKSLPLSCTSKMKPELCFFPQY
VVPSMRTPLFVINAAFDSWQIKNVLAPTAVDKSKEWKNCKLDLKKCSAAQ
LRTVQGFRDQMMRALSPVHSTPSRGLFLDSCHAHCQGGSAASWSGVKGPQ
VANTRIATAVGNWFYGRSAFQKIDCPSPTCNPTCPAISTED


Reference
    Title: The Capsella rubella genome and the genomic consequences of rapid mating system evolution
    Slotte T, Hazzouri KM, Agren JA, Koenig D, Maumus F, Guo YL, Steige K, Platts AE, Escobar JS and Wright SI <26 more author(s)>
    Ref: Nat Genet, 45:831, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer