Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9bras-r0hjs5

Capsella rubella, Putative uncharacterized protein

Relationship
Family|Duf_1350
Block| X
Position in NCBI Life Tree|Capsella rubella
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Viridiplantae: N E > Streptophyta: N E > Streptophytina: N E > Embryophyta: N E > Tracheophyta: N E > Euphyllophyta: N E > Spermatophyta: N E > Magnoliophyta: N E > Mesangiospermae: N E > eudicotyledons: N E > Gunneridae: N E > Pentapetalae: N E > rosids: N E > malvids: N E > Brassicales: N E > Brassicaceae: N E > Camelineae: N E > Capsella: N E > Capsella rubella: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : XP_002875610, XP_006279072, XP_006291225
3 UniProt : D7LMA4, R0GI39, R0HJS5
3 Interpro : D7LMA4, R0GI39, R0HJS5
3 Prodom : D7LMA4, R0GI39, R0HJS5
3 Pfam : D7LMA4, R0GI39, R0HJS5
3 PIRSF : D7LMA4, R0GI39, R0HJS5
3 SUPERFAM : D7LMA4, R0GI39, R0HJS5
Sequence
Graphical view for this peptide sequence: 9bras-r0hjs5
Colored MSA for Duf_1350 (raw)
FVFTKANSLPNLKKKKKKKKLNLYVLLSSFSTTMEFALATSSFLGTQVIP
ATLFCKRVRAVSLTVTASGSYNRSRNDKVYTRLDTCLVIPPPPRFKKPRA
IVKFLGGAFVGAVPELTYSYLKELLAKEGFLIVSVPYNVTFDHEQAAKQV
YERFNSCLDKIVSSGIPNANFKAEDLADLPLFSVGHSNGALLQVLTGSYF
SEKIPKVNAIISFNNKSATEAVPYFEQLGPLIQQMMPVVEASPVYEMARN
ASGDVLKLLLDTAGTTILNNDQEALKSFTNLVDQLPSVFGEVGQGVSEFR
PSPLENRNRFKCSYSVPHTLLVQFNSDAIDETDLLEETLRPRIESIGGTL
EKVRLSGNHLTPCIQDPKWQIGSVYTPADAVAQALKTIPLSETRVLSRTI
ADWFRQFEN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

FVFTKANSLPNLKKKKKKKKLNLYVLLSSFSTTMEFALATSSFLGTQVIP
ATLFCKRVRAVSLTVTASGSYNRSRNDKVYTRLDTCLVIPPPPRFKKPRA
IVKFLGGAFVGAVPELTYSYLKELLAKEGFLIVSVPYNVTFDHEQAAKQV
YERFNSCLDKIVSSGIPNANFKAEDLADLPLFSVGHSNGALLQVLTGSYF
SEKIPKVNAIISFNNKSATEAVPYFEQLGPLIQQMMPVVEASPVYEMARN
ASGDVLKLLLDTAGTTILNNDQEALKSFTNLVDQLPSVFGEVGQGVSEFR
PSPLENRNRFKCSYSVPHTLLVQFNSDAIDETDLLEETLRPRIESIGGTL
EKVRLSGNHLTPCIQDPKWQIGSVYTPADAVAQALKTIPLSETRVLSRTI
ADWFRQFEN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer