Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-EstA

Burkholderia stabilis triacylglycerol lipase EstA

Relationship
Family|Bacterial_lip_FamI.2
Block| L
Position in NCBI Life Tree|Burkholderia stabilis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia stabilis: N E


Molecular evidence
Database
No mutation
2 structures: 7COF, 7COG
No kinetic





No Substrate
No inhibitor
1 Genbank : WP_096474789
2 Structure : 7COF, 7COG
Sequence
Graphical view for this peptide sequence: 9burk-EstA
Colored MSA for Bacterial_lip_FamI.2 (raw)
MARSMRSRVVAGAVACAMSVAPFAGTTAVMTLATTHAAMAATAPADDYAT
TRYPIVLVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVAS
VTTIGTPHRGSEFADFVQGVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALASLKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMI
NRGSGQNDGLVSKCSALYGQVLSTSYKWNHIDEINQLLGVRGAFAEDPVA
VIRTHANRLKLAGV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MARSMRSRVVAGAVACAMSVAPFAGTTAVMTLATTHAAMAATAPADDYAT
TRYPIVLVHGLTGTDKYAGVLEYWYGIQEDLQQHGATVYVANLSGFQSDD
GPNGRGEQLLAYVKTVLAATGATKVNLVGHSQGGLTSRYVAAVAPDLVAS
VTTIGTPHRGSEFADFVQGVLAYDPTGLSSSVIAAFVNVFGILTSSSHNT
NQDALASLKTLTTAQAATYNQNYPSAGLGAPGSCQTGAPTETVGGNTHLL
YSWAGTAIQPTLSVFGVTGATDTSTIPLVDPANALDPSTLALFGTGTVMI
NRGSGQNDGLVSKCSALYGQVLSTSYKWNHIDEINQLLGVRGAFAEDPVA
VIRTHANRLKLAGV


References
    Title: Bacterial triacylglycerol lipase is a potential cholesterol esterase: Identification of a key determinant for sterol-binding specificity
    Yasutake Y, Konishi K, Muramatsu S, Yoshida K, Aburatani S, Sakasegawa SI, Tamura T
    Ref: Int J Biol Macromol, 167:578, 2021 : PubMed

            

    Title: Production of recombinant extracellular cholesterol esterase using consistently active promoters in Burkholderia stabilis
    Yoshida K, Konishi K, Magana-Mora A, Rougny A, Yasutake Y, Muramatsu S, Murata S, Kumagai T, Aburatani S and Tamura T <1 more author(s)>
    Ref: Biosci Biotechnol Biochem, 83:1974, 2019 : PubMed

            

    Title: Complete Genome Sequence of Burkholderia stabilis FERMP-21014
    Konishi K, Kumagai T, Sakasegawa SI, Tamura T
    Ref: Genome Announc, 5:, 2017 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer