Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-EstL

Roseateles depolymerans. plastic degrading esterase EstL

Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Roseateles depolymerans
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > Burkholderiales Genera incertae sedis: N E > Roseateles: N E > Roseateles depolymerans: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
Sequence
Graphical view for this peptide sequence: 9burk-EstL
Colored MSA for Polyesterase-lipase-cutinase (raw)
MTLTSSLRRQTRVAALAAAAALTGLALPASAQQTGPDPTSAGLNATAGPF
AVGSTSVLAPVGFGGGTIYYPTTAGQYGVVAMSPGFTATESSIAWLGRRL
ATHGFVVVTINTLTTLDQPASRATQLMAALNHVVNSASSTVRSRVDPNRR
AVAGHSMGGGGALIAAENNPSLKAALPLTPWNLTTNFSDVQVPTLIVGAD
GDTIAPVAVHARPFYASLSSSVRKAYAELNFSTHFTPNSTNTPIGRYGVT
WMKRFVDGDTRYSSFLCGAEHNAYATSLVFERYSQNCPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTLTSSLRRQTRVAALAAAAALTGLALPASAQQTGPDPTSAGLNATAGPF
AVGSTSVLAPVGFGGGTIYYPTTAGQYGVVAMSPGFTATESSIAWLGRRL
ATHGFVVVTINTLTTLDQPASRATQLMAALNHVVNSASSTVRSRVDPNRR
AVAGHSMGGGGALIAAENNPSLKAALPLTPWNLTTNFSDVQVPTLIVGAD
GDTIAPVAVHARPFYASLSSSVRKAYAELNFSTHFTPNSTNTPIGRYGVT
WMKRFVDGDTRYSSFLCGAEHNAYATSLVFERYSQNCPY


Reference
    Title: Gene structure and comparative study of two different plastic-degrading esterases fromRoseateles depolymeransstrain TB-87
    Ahmad A, Tsutsui A, Iijim S, Suzuki T, Shaha AA, Nakajima-kambe T
    Ref: Polymer Degradation and Stability, 164:109, 2019 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer