Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-Q5YEW3

Schlegelella sp. KB1a PHB depolymerase (phaZ) gene

Comment
c-term Fibronectin 3 domain excluded


Relationship
Family|Esterase_phb_PHAZ
Block| X
Position in NCBI Life Tree|Schlegelella sp. KB1a
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Schlegelella: N E > Schlegelella sp. KB1a: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AY538710
1 UniProt : Q5YEW3
1 UniProt : Q5YEW3
1 Interpro : Q5YEW3
1 Pfam : Q5YEW3
1 PIRSF : Q5YEW3
1 SUPERFAM : Q5YEW3
Sequence
Graphical view for this peptide sequence: 9burk-Q5YEW3
Colored MSA for Esterase_phb_PHAZ (raw)
MRSIRLKRLIAAVALGGAAAATQAASPLPRLNVDKTQISVSGLSAGGFMA
NQLGYAYSGTFMGVGIFAGGPYMCAGHSNYTSCMYNATITSSMRSAMQAS
IDNWSGAHIDPKAHVANQRVFLFVGNSDTTVGPNPMDAVHAQYQHNGVRR
TARVRGRNSTAHVFPTDFDATGNNACNSTASPYIANCGYDGAKAVLSRIY
GTLQPRNDAPAGANYIEFDQTAFTNNPGMASTGWVYVPANCAAGAQCRLH
VALHGCQQSTGHIGDRFVKNTGYTRWADTNNIIVLFPQAKTDNTPRNTAA
SGMLPNPNACWDWVGWYGSNFAQKTGTQAAAIKAMVDHVAS
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRSIRLKRLIAAVALGGAAAATQAASPLPRLNVDKTQISVSGLSAGGFMA
NQLGYAYSGTFMGVGIFAGGPYMCAGHSNYTSCMYNATITSSMRSAMQAS
IDNWSGAHIDPKAHVANQRVFLFVGNSDTTVGPNPMDAVHAQYQHNGVRR
TARVRGRNSTAHVFPTDFDATGNNACNSTASPYIANCGYDGAKAVLSRIY
GTLQPRNDAPAGANYIEFDQTAFTNNPGMASTGWVYVPANCAAGAQCRLH
VALHGCQQSTGHIGDRFVKNTGYTRWADTNNIIVLFPQAKTDNTPRNTAA
SGMLPNPNACWDWVGWYGSNFAQKTGTQAAAIKAMVDHVAS


Reference
    Title: Thermotolerant poly(3-hydroxybutyrate)-degrading bacteria from hot compost and characterization of the PHB depolymerase of Schlegelella sp. KB1a
    Romen F, Reinhardt S, Jendrossek D
    Ref: Arch Microbiol, 182:157, 2004 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer