Gene_locus Report for: 9burk-a0a0q4rwb0Acidovorax sp. Uncharacterized protein Comment Other strains: Acidovorax sp. Leaf76 Relationship (Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Acidovorax: N E > Acidovorax sp.: N E
6_AlphaBeta_hydrolase : acisj-a1w6g3Acidovorax sp. (strain JS42) alpha/beta hydrolase fold, acisj-a1w6h1Acidovorax sp. (strain JS42) alpha/beta hydrolase fold, acisj-a1w9h2Acidovorax sp. (strain JS42) alpha/beta hydrolase fold, acisj-a1w249Acidovorax sp. (strain JS42) Alpha/beta hydrolase fold, acisj-a1w562Acidovorax sp. (strain JS42) alpha/beta hydrolase fold, acisj-a1wak0Acidovorax sp. (strain JS42) alpha/beta hydrolase fold. BD-FAE : 9burk-a0a0q0xy66Acidovorax sp. Uncharacterized protein, 9burk-a0a0q9cyx0Acidovorax sp. Uncharacterized protein. Carbon-carbon_bond_hydrolase : acisj-a1w6c9Acidovorax sp. (strain JS42) alpha/beta hydrolase fold. Carboxymethylbutenolide_lactonase : acisj-a1wbn5Acidovorax sp. (strain JS42) Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY)) 3-oxoadipate enol-lactonase. Carb_B_Bacteria : 9burk-a0a0q0xf18Acidovorax sp.; Burkholderiales bacterium Uncharacterized protein, 9burk-a0a0q4rzl6Acidovorax sp. Uncharacterized protein, 9burk-a0a0q6zmw1Acidovorax sp. Uncharacterized protein, 9burk-a0a0q7adf6Acidovorax sp. . Para-nitrobenzyl esterase, 9burk-a0a0q8l177Acidovorax sp. Uncharacterized protein, 9burk-a0a0q8le23Acidovorax sp. Uncharacterized protein, 9burk-a0a0q8s6s0Acidovorax sp. Uncharacterized protein, 9burk-a0a0q8sfs4Acidovorax sp. Uncharacterized protein, 9burk-a0a0q8t7s9Acidovorax sp. Uncharacterized protein, 9burk-a0a0q9d4j7Acidovorax sp. Uncharacterized protein, 9burk-a0a0q9dlh2Acidovorax sp. Uncharacterized protein, 9burk-a0a0q9dvs7Acidovorax sp. Uncharacterized protein. Duf_3141 : acisj-a1w9c9Acidovorax sp. (strain JS42) Putative uncharacterized protein, acisj-a1w603Acidovorax sp. (strain JS42) Putative uncharacterized protein. Epoxide_hydrolase : acisj-a1w3x7Acidovorax sp. Acidovorax ebreus (Diaphorobacter sp.) Alpha/beta hydrolase fold protein. Homoserine_transacetylase : acisj-a1wda1Acidovorax sp. (strain JS42) Homoserine O-acetyltransferase. UCP037442 : acisj-a1w3l8Acidovorax sp. (strain JS42) Acidovorax ebreus (strain TPSY) (Diaphorobacter sp. (strain TPSY)) Putative hydrolase Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)Acidovorax sp. Leaf78: N, E.
Acidovorax sp. Leaf76: N, E.
Molecular evidence | | Database | No mutation No structure No kinetic
No Substrate No inhibitor
| |
|
Sequence Graphical view for this peptide sequence: 9burk-a0a0q4rwb0 Colored MSA for BD-FAE (raw)
MSLPLNDPAWLERMYNNRALVPDHMDYLQRWAKTSADVRASQPCVLDVAY
GTGVRETLDIFPAARTAPGGVPVLVFIHGGYWRALDKSDHSFIAPPFTQA
GFCVVVVNYALCPGTPEAPVTIPHIVRQMEKAVAWVARSITGHGGDPRRI
TVAGHSAGGHLAAMMLTSVWSLIGNGLPDGLVRSALSISGVHDLEPLKHT
PFLQDALHLTDQHVLQDSPSRLLAPEHGILYCVAGGDESEEFRRQNGLVL
QSWGEHSVPRCQILPGLHHFSILDTLAQPGKDLHHMAQNLLRM
Legend
This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA
MSLPLNDPAWLERMYNNRALVPDHMDYLQRWAKTSADVRASQPCVLDVAY GTGVRETLDIFPAARTAPGGVPVLVFIHGGYWRALDKSDHSFIAPPFTQA GFCVVVVNYALCPGTPEAPVTIPHIVRQMEKAVAWVARSITGHGGDPRRI TVAGHSAGGHLAAMMLTSVWSLIGNGLPDGLVRSALSISGVHDLEPLKHT PFLQDALHLTDQHVLQDSPSRLLAPEHGILYCVAGGDESEEFRRQNGLVL QSWGEHSVPRCQILPGLHHFSILDTLAQPGKDLHHMAQNLLRM
|
|
|