Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a0q7biu2

Pelomonas sp.. Uncharacterized protein

Comment
Other strains: Pelomonas sp. Root405


Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Pelomonas sp. Root405
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Pelomonas: N E > Pelomonas sp. Root405: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LMDU01000001, WP_056263837
1 UniProt : A0A0Q7BIU2
2 UniProt : A0A0Q7BIU2, A0A0Q8HAY5
2 Interpro : A0A0Q7BIU2, A0A0Q8HAY5
2 Pfam : A0A0Q7BIU2, A0A0Q8HAY5
2 PIRSF : A0A0Q7BIU2, A0A0Q8HAY5
2 SUPERFAM : A0A0Q7BIU2, A0A0Q8HAY5
Sequence
Graphical view for this peptide sequence: 9burk-a0a0q7biu2
Colored MSA for Abhydrolase_7 (raw)
MTALRRQLLAALAAWPLLGRTDTLDATLAGLQRRWRPRLAWRPDPGWRAE
ALAIARRLILQPGNDGRGFATEVLAEQDRDGHTAQALTLRGALGDRVPAL
YLRPKGDGPHPAVVVMHDHGARFDIGKEKLVRPLTASPSADAWVQRYYGG
AFVGDPLVEAGFAVLAIDALGWGERSRPGFARDDQQAVANHLLQLGHSWA
GVIASDDLRSHRWLREQPGIDPQRVAVLGFSMGAFRAWQLAAVSDEVSAC
VSAHWMCTREGLLRPGEHTLVGQSAFSMAHPRLAAELDHPDVAALIAPRP
LMLLGSKEDKLFPWDAAQQAWARLAPAWGGNTGFRTQVTSGGHRFDVEQQ
RAATAWLRRHAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTALRRQLLAALAAWPLLGRTDTLDATLAGLQRRWRPRLAWRPDPGWRAE
ALAIARRLILQPGNDGRGFATEVLAEQDRDGHTAQALTLRGALGDRVPAL
YLRPKGDGPHPAVVVMHDHGARFDIGKEKLVRPLTASPSADAWVQRYYGG
AFVGDPLVEAGFAVLAIDALGWGERSRPGFARDDQQAVANHLLQLGHSWA
GVIASDDLRSHRWLREQPGIDPQRVAVLGFSMGAFRAWQLAAVSDEVSAC
VSAHWMCTREGLLRPGEHTLVGQSAFSMAHPRLAAELDHPDVAALIAPRP
LMLLGSKEDKLFPWDAAQQAWARLAPAWGGNTGFRTQVTSGGHRFDVEQQ
RAATAWLRRHAA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer