Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a0q7ctp0

Methylibium sp. Root1272. Uncharacterized protein

Relationship
Family|VirJ
Block| X
Position in NCBI Life Tree|Methylibium sp. Root1272
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > Burkholderiales Genera incertae sedis: N E > Methylibium: N E > Methylibium sp. Root1272: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LMDY01000014, WP_056321342
1 UniProt : A0A0Q7CTP0
1 UniProt : A0A0Q7CTP0
1 Interpro : A0A0Q7CTP0
1 Pfam : A0A0Q7CTP0
1 PIRSF : A0A0Q7CTP0
1 SUPERFAM : A0A0Q7CTP0
Sequence
Graphical view for this peptide sequence: 9burk-a0a0q7ctp0
Colored MSA for VirJ (raw)
MSGRRALAFAVALAGAVMASVAAPARTAPPASAPLQKPAAAAAPTVSHGL
FTGVQVFRPAGEVKQFVLMLADEAGPDATERQLLQSMTKAGALVAAVPLA
PFHRRLEAQGGSCLYAAGAFENLAHQVQAIEKLPTYLEPLLVGAGTPRAA
FAYGVLAQAPAGSFVSALSLGFCPRLDDRTPLCATNALRWQAAAGGRGVE
LLPATQAIAPWAAVQSGDETAACSASVAQAFVARVAQASWVALPPGTGAA
TPGKSDATAGFDAAYARLAAYRVSLGAPPAQLADLPIVEVPATAAAGGDA
GNARRFAVLLSGDGGWAGIDKSIAAALAKQGVPVAGFDSLRYFWSARTPE
GLAADLDRLIRYYAARWQRSEVLLIGYSQGADVLPFAINRLPARTRASVR
LTALLGLGQKAAFEFHVTHWIGASGDRPIAPEAQKLSAAGTLCIHGSDER
DSLCPQLAPKHVRALVLPGGHHFGGDYDALAGRILEAVPVSPPPR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSGRRALAFAVALAGAVMASVAAPARTAPPASAPLQKPAAAAAPTVSHGL
FTGVQVFRPAGEVKQFVLMLADEAGPDATERQLLQSMTKAGALVAAVPLA
PFHRRLEAQGGSCLYAAGAFENLAHQVQAIEKLPTYLEPLLVGAGTPRAA
FAYGVLAQAPAGSFVSALSLGFCPRLDDRTPLCATNALRWQAAAGGRGVE
LLPATQAIAPWAAVQSGDETAACSASVAQAFVARVAQASWVALPPGTGAA
TPGKSDATAGFDAAYARLAAYRVSLGAPPAQLADLPIVEVPATAAAGGDA
GNARRFAVLLSGDGGWAGIDKSIAAALAKQGVPVAGFDSLRYFWSARTPE
GLAADLDRLIRYYAARWQRSEVLLIGYSQGADVLPFAINRLPARTRASVR
LTALLGLGQKAAFEFHVTHWIGASGDRPIAPEAQKLSAAGTLCIHGSDER
DSLCPQLAPKHVRALVLPGGHHFGGDYDALAGRILEAVPVSPPPR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer