Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a0q7sk72

Pelomonas sp. Root1444. Uncharacterized protein

Relationship
Family|Abhydrolase_7
Block| X
Position in NCBI Life Tree|Pelomonas sp. Root1444
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Pelomonas: N E > Pelomonas sp. Root1444: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LMFP01000003, WP_056873739
1 UniProt : A0A0Q7SK72
1 UniProt : A0A0Q7SK72
1 Interpro : A0A0Q7SK72
1 Pfam : A0A0Q7SK72
1 PIRSF : A0A0Q7SK72
1 SUPERFAM : A0A0Q7SK72
Sequence
Graphical view for this peptide sequence: 9burk-a0a0q7sk72
Colored MSA for Abhydrolase_7 (raw)
MTARRRQLLAALAAWPLLARADALDDALAALQRRWRPSLAWRPDPAWRTE
ALATARRLVLLPGDDGSAFATEVLGEQDRGGHTAQALTLRGALGDRVPAL
YLRPKGDGPHPAVVVMHDHGARFDIGKEKLVRPLTASPSAEAWVQRYYGG
TFVGDTLADAGFAVLAIDALGWGERGRPGFARDDQQALANHLMQLGHSWA
GLIASDDLRSHRWLRERPEVDAKRVAVLGFSMGALRAWQLAAVCEDVSAC
VAAHWMCTREGLLRAGEHTLQGQSAFSMAHPGLAAVLDHPDVAALIAPRP
LLLFGSPDDKLFPWDAAQAAWSQLGRAWRQHGADSRLTTQATAGGHRFDV
EQQQAATHWLRRAA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTARRRQLLAALAAWPLLARADALDDALAALQRRWRPSLAWRPDPAWRTE
ALATARRLVLLPGDDGSAFATEVLGEQDRGGHTAQALTLRGALGDRVPAL
YLRPKGDGPHPAVVVMHDHGARFDIGKEKLVRPLTASPSAEAWVQRYYGG
TFVGDTLADAGFAVLAIDALGWGERGRPGFARDDQQALANHLMQLGHSWA
GLIASDDLRSHRWLRERPEVDAKRVAVLGFSMGALRAWQLAAVCEDVSAC
VAAHWMCTREGLLRAGEHTLQGQSAFSMAHPGLAAVLDHPDVAALIAPRP
LLLFGSPDDKLFPWDAAQAAWSQLGRAWRQHGADSRLTTQATAGGHRFDV
EQQQAATHWLRRAA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer