Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a158f2z2

Caballeronia udeis. D-(-)-3-hydroxybutyrate oligomer hydrolase

Relationship
Family|OHBut_olig_hydro_put
Block| X
Position in NCBI Life Tree|Caballeronia udeis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Caballeronia: N E > Caballeronia udeis: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : FCOK02000002, WP_062081792.1
1 UniProt : A0A158F2Z2
1 UniProt : A0A158F2Z2
1 Interpro : A0A158F2Z2
1 Prodom : A0A158F2Z2
1 Pfam : A0A158F2Z2
1 PIRSF : A0A158F2Z2
1 SUPERFAM : A0A158F2Z2
Sequence
Graphical view for this peptide sequence: 9burk-a0a158f2z2
Colored MSA for OHBut_olig_hydro_put (raw)
MKRFPGATALALALAAFGLAACHGDDDGNGNSSQNNVLPNFISGSVRTQS
YDGTTDDLLTAGLGKDGLASATPPAIANPAAPSAADLRRLAIYSNYRALV
DMSANGGYGRFWGPNVDLNGNDTLGEGMIAGKEYLAFADDGSGTLNVSLL
VQIPASFNPGQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKGS
GNGAHELATNTVTLIDGTLFNAAAAGKTSVFTANLGSTSLAAFNAQFPNR
YAFKHAHSQQNPEKSWGTNTLQAIQFAYWALNDTYGSLDGSTRKIRYNRG
DVTTIAASVSNGGGASLAAAEQDTQGWITAVVVGEPQINLNVPSQVSVRQ
GGVQVASFGRPLADYMTLANLLQPCAALAPAAAGAPYLTALPAATTASIR
AARCASLAANGVITGGDVISQATNALAQLHQAGYQTDSDLLQAPMWDSQA
VPAVAVTYANAYTQSSVADNLCNFSFGTTNAVTGAAGVSPLVSPMLTVFG
NGNGVPPTNGINLVYNAGNAGNSGAADHRFATADASFAGAFCLRGLWTNG
DARMTASVNAIRVNANLHGKPAIIVQGRSDTLVPINHASRPYAAMNKLAE
GNSSNLSFYEVTNGQHFDAFLSVAGFDTRFVPLQYYNLQALNLMWAHLMN
GAPLPPSQVVHTVPRGGTAGAAPALSLNNLPAISASPGANAITFGGGGVN
VPN
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKRFPGATALALALAAFGLAACHGDDDGNGNSSQNNVLPNFISGSVRTQS
YDGTTDDLLTAGLGKDGLASATPPAIANPAAPSAADLRRLAIYSNYRALV
DMSANGGYGRFWGPNVDLNGNDTLGEGMIAGKEYLAFADDGSGTLNVSLL
VQIPASFNPGQPCIVTATSSGSRGVYGAISAAGEWGLKRGCAVAYTDKGS
GNGAHELATNTVTLIDGTLFNAAAAGKTSVFTANLGSTSLAAFNAQFPNR
YAFKHAHSQQNPEKSWGTNTLQAIQFAYWALNDTYGSLDGSTRKIRYNRG
DVTTIAASVSNGGGASLAAAEQDTQGWITAVVVGEPQINLNVPSQVSVRQ
GGVQVASFGRPLADYMTLANLLQPCAALAPAAAGAPYLTALPAATTASIR
AARCASLAANGVITGGDVISQATNALAQLHQAGYQTDSDLLQAPMWDSQA
VPAVAVTYANAYTQSSVADNLCNFSFGTTNAVTGAAGVSPLVSPMLTVFG
NGNGVPPTNGINLVYNAGNAGNSGAADHRFATADASFAGAFCLRGLWTNG
DARMTASVNAIRVNANLHGKPAIIVQGRSDTLVPINHASRPYAAMNKLAE
GNSSNLSFYEVTNGQHFDAFLSVAGFDTRFVPLQYYNLQALNLMWAHLMN
GAPLPPSQVVHTVPRGGTAGAAPALSLNNLPAISASPGANAITFGGGGVN
VPN



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer