Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a1e7w6l2

Duganella phyllosphaerae. Alpha/beta hydrolase family protein

Relationship
Family|UCP031982
Block| X
Position in NCBI Life Tree|Duganella phyllosphaerae
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Duganella: N E > Duganella phyllosphaerae: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : LROM01000152, WP_070252073
1 UniProt : A0A1E7W6L2
1 UniProt : A0A1E7W6L2
1 Interpro : A0A1E7W6L2
1 Pfam : A0A1E7W6L2
1 PIRSF : A0A1E7W6L2
1 SUPERFAM : A0A1E7W6L2
Sequence
Graphical view for this peptide sequence: 9burk-a0a1e7w6l2
Colored MSA for UCP031982 (raw)
MAACGCRLLEVVDTVQKAMIPLALLYPAHGVETTEQFGPYSLAVAIDAAP
VGGTFPLVVVSHGNAGTPWAYRELARHLVQHGYIVALPAHTGNTRHNNNR
ANTAANLANRPRHITLVIDAAYQQLKDHLKPDCVAVIGHSIGGYTALAVA
GGKPWTGPYERKANPPQPVLVTPDYRVRALVLLAPATAWFRPGALRAVRV
PVLMITGDQDVNTPVAHALNVLDGVADRAQVVHKVFAGAAHFSFMSKFPA
EMTKPEFHPSQDPPGFDRADIQAGLFDDISAFLLRTVGTVAALPDNETV
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MAACGCRLLEVVDTVQKAMIPLALLYPAHGVETTEQFGPYSLAVAIDAAP
VGGTFPLVVVSHGNAGTPWAYRELARHLVQHGYIVALPAHTGNTRHNNNR
ANTAANLANRPRHITLVIDAAYQQLKDHLKPDCVAVIGHSIGGYTALAVA
GGKPWTGPYERKANPPQPVLVTPDYRVRALVLLAPATAWFRPGALRAVRV
PVLMITGDQDVNTPVAHALNVLDGVADRAQVVHKVFAGAAHFSFMSKFPA
EMTKPEFHPSQDPPGFDRADIQAGLFDDISAFLLRTVGTVAALPDNETV


Reference
    Title: Molecular Keys to the Janthinobacterium and Duganella spp. Interaction with the Plant Pathogen Fusarium graminearum
    Haack FS, Poehlein A, Kroger C, Voigt CA, Piepenbring M, Bode HB, Daniel R, Schafer W, Streit WR
    Ref: Front Microbiol, 7:1668, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer