Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a0a1f4jxw8

Burkholderiales bacterium RIFCSPLOWO2_02_FULL_57_36 DLH domain-containing protein A3I66_11710 PbPL

Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Burkholderiales bacterium RIFCSPLOWO2_02_FULL_57_36
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > unclassified Burkholderiales: N E > unclassified Burkholderiales (miscellaneous): N E > Burkholderiales bacterium RIFCSPLOWO2_02_FULL_57_36: N E


Molecular evidence
Database
No mutation
1 structure:
7CWQ: Crystal structure of a novel hydrolase from Burkholderiales bacterium
No kinetic





No Substrate
No inhibitor
1 Genbank : OGB27210
1 UniProt : A0A1F4JXW8
1 Structure : 7CWQ
1 UniProt : A0A1F4JXW8
1 Interpro : A0A1F4JXW8
1 Prodom : A0A1F4JXW8
1 Pfam : A0A1F4JXW8
1 PIRSF : A0A1F4JXW8
1 SUPERFAM : A0A1F4JXW8
Sequence
Graphical view for this peptide sequence: 9burk-a0a1f4jxw8
Colored MSA for Polyesterase-lipase-cutinase (raw)
MNPFEKGPDPTKTMLEASTGPFTYTTTTVSSTTASGYRQGTIYHPTNVTG
PFAAVAVVPGYLASQSSINWWGPRLASHGFVVITIDTNSTSDQPPSRATQ
LMAALNQLKTFSNTSSHPIYRKVDPNRLGVMGWSMGGGGTLIAARDNPTL
KAAIPFAPWNSSTNFSTVSVPTLIIACESDSTAPVNSHASPFYNSLPSTT
KKAYLEMNNGSHSCANSGNSNAGLIGKYGVSWMKRFMDNDTRFSPYLCGA
PHQADLSLTAIDEYRENCPY
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNPFEKGPDPTKTMLEASTGPFTYTTTTVSSTTASGYRQGTIYHPTNVTG
PFAAVAVVPGYLASQSSINWWGPRLASHGFVVITIDTNSTSDQPPSRATQ
LMAALNQLKTFSNTSSHPIYRKVDPNRLGVMGWSMGGGGTLIAARDNPTL
KAAIPFAPWNSSTNFSTVSVPTLIIACESDSTAPVNSHASPFYNSLPSTT
KKAYLEMNNGSHSCANSGNSNAGLIGKYGVSWMKRFMDNDTRFSPYLCGA
PHQADLSLTAIDEYRENCPY


Reference
    Title: General features to enhance enzymatic activity of poly(ethylene terephthalate) hydrolysis
    Chen CC, Han X, Li X, Jiang P, Niu D, Ma L, Liu W, Li S, Qu Y and Chen, CC <8 more author(s)>
    Ref: Nature Catalysis, 4:425, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer