Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-a7kx00

Pandoraea pnomenusa 2-hydroxy-6-oxohepta-2,4-dienoate hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Pandoraea pnomenusa
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Pandoraea: N E > Pandoraea pnomenusa: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : EF600714
1 UniProt : A7KX00
1 UniProt : A7KX00
1 Interpro : A7KX00
1 Prodom : A7KX00
1 Pfam : A7KX00
1 PIRSF : A7KX00
1 SUPERFAM : A7KX00
Sequence
Graphical view for this peptide sequence: 9burk-a7kx00
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MTNANPEVGRTVRAGGIETNLHDIGEGKPVVLVHGSGPGVTAWANWRTVM
PGLSRRRRVIAPDMVGFGFTQRPQGIRYGIDSWVEHLTGVLDALELDQVD
LVGNSFGGALSLAFAIRFPQRVRRLVLMGSVGVKFELTDGLEAVWGYEPS
VPNMRKVMDFFAYDRSLVSDELAELRYSASIRPGFQEAFASMFPAPRQRW
IDALASPDQDIQAIRHQTLILHGRDDRVIPLETSLRLNQLIESSQLHVFG
KCGHWVQIEQNQSFLRLVDGFLTPEDRSQD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTNANPEVGRTVRAGGIETNLHDIGEGKPVVLVHGSGPGVTAWANWRTVM
PGLSRRRRVIAPDMVGFGFTQRPQGIRYGIDSWVEHLTGVLDALELDQVD
LVGNSFGGALSLAFAIRFPQRVRRLVLMGSVGVKFELTDGLEAVWGYEPS
VPNMRKVMDFFAYDRSLVSDELAELRYSASIRPGFQEAFASMFPAPRQRW
IDALASPDQDIQAIRHQTLILHGRDDRVIPLETSLRLNQLIESSQLHVFG
KCGHWVQIEQNQSFLRLVDGFLTPEDRSQD


Reference
    Title: Genetic and biochemical analyses of chlorobenzene degradation gene clusters in Pandoraea sp. strain MCB032
    Jiang XW, Liu H, Xu Y, Wang SJ, Leak DJ, Zhou NY
    Ref: Arch Microbiol, 191:485, 2009 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer