Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-b5whg4

Burkholderia sp. H160 Haloalkane dehalogenase

Relationship
Family|Haloalkane_dehalogenase-HLD2
Block| X
Position in NCBI Life Tree|Burkholderia sp. H160
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia sp. H160: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : ABYL01000028
Sequence
Graphical view for this peptide sequence: 9burk-b5whg4
Colored MSA for Haloalkane_dehalogenase-HLD2 (raw)
MTPLFDVELPHVNVLDSTMAYREAGNPDAAVALFLHGNPTSSYIWRKIIP
LVAPVAHCIAPDLIGFGQSGKPDIEYRFADHVRYLDAFLAKAGISSAFVI
AQDWGTALAFHLAARRPEFMRGLAFMEFIWAMPTWDDFHADARETFQKFR
TPVVGEQMILKDNAFVEQVLPGATVRKLTDEEMSVYRAPFPTAESRRPTW
RFPNELPIAGQPADVCSTLESAHRALAQSSYPKLLFTATPGALVAPSVAK
RFASNIKDCKVIELGFGIHYLQEDHPDLIGTTLSEWLIELGADSSSPK
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTPLFDVELPHVNVLDSTMAYREAGNPDAAVALFLHGNPTSSYIWRKIIP
LVAPVAHCIAPDLIGFGQSGKPDIEYRFADHVRYLDAFLAKAGISSAFVI
AQDWGTALAFHLAARRPEFMRGLAFMEFIWAMPTWDDFHADARETFQKFR
TPVVGEQMILKDNAFVEQVLPGATVRKLTDEEMSVYRAPFPTAESRRPTW
RFPNELPIAGQPADVCSTLESAHRALAQSSYPKLLFTATPGALVAPSVAK
RFASNIKDCKVIELGFGIHYLQEDHPDLIGTTLSEWLIELGADSSSPK


Reference
    Title: Genome sequences of Burkholderia sp. strains CCGE1002 and H160, isolated from legume nodules in Mexico and Brazil
    Ormeno-Orrillo E, Rogel MA, Chueire LM, Tiedje JM, Martinez-Romero E, Hungria M
    Ref: Journal of Bacteriology, 194:6927, 2012 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer