Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-l9pl81

Janthinobacterium sp. HH01 Uncharacterized protein

Relationship
Family|Est9X
Block| H
Position in NCBI Life Tree|Janthinobacterium sp. HH01
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Oxalobacteraceae: N E > Janthinobacterium: N E > Janthinobacterium sp. HH01: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AMWD01000001
1 UniProt : L9PL81
1 UniProt : L9PL81
1 Interpro : L9PL81
1 Prodom : L9PL81
1 Pfam : L9PL81
1 PIRSF : L9PL81
1 SUPERFAM : L9PL81
Sequence
Graphical view for this peptide sequence: 9burk-l9pl81
Colored MSA for Est9X (raw)
MLNKMGRTLLAAAVAGNVGAAGAAPMTLQDYLALSGPAPTQHVAYGPAPS
QFAELFQPSGDGPFPVAVIVHGGCWTKEFGGITQMHNMAGALQQRGIAVW
NVEYRRFDEEGGGYPGMYHDVGTALDRLRVLAPERRLDLSRIVLVGHSAG
GHLAQWAASRARLPRSSPLYVADPLPVPTVISLGGLADLRNEQSLIKTSC
DRDMAQLAGTASAARPDIFSDTSPAELLPAGVRTVLIHGEFDTISPLRAG
QDYARRAQAAGDHAEVIVLPGGSHYDEVAASSPSWTIVSAQIRKALGL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLNKMGRTLLAAAVAGNVGAAGAAPMTLQDYLALSGPAPTQHVAYGPAPS
QFAELFQPSGDGPFPVAVIVHGGCWTKEFGGITQMHNMAGALQQRGIAVW
NVEYRRFDEEGGGYPGMYHDVGTALDRLRVLAPERRLDLSRIVLVGHSAG
GHLAQWAASRARLPRSSPLYVADPLPVPTVISLGGLADLRNEQSLIKTSC
DRDMAQLAGTASAARPDIFSDTSPAELLPAGVRTVLIHGEFDTISPLRAG
QDYARRAQAAGDHAEVIVLPGGSHYDEVAASSPSWTIVSAQIRKALGL


Reference
    Title: The Janthinobacterium sp. HH01 genome encodes a homologue of the V. cholerae CqsA and L. pneumophila LqsA autoinducer synthases
    Hornung C, Poehlein A, Haack FS, Schmidt M, Dierking K, Pohlen A, Schulenburg H, Blokesch M, Plener L and Streit WR <11 more author(s)>
    Ref: PLoS ONE, 8:e55045, 2013 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer