Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-q0gqt7

Delftia sp. AN3, uncultured bacterium, 2-hydroxymuconic semialdehyde hydrolase

Relationship
Family|Carbon-carbon_bond_hydrolase
Block| X
Position in NCBI Life Tree|Delftia sp. AN3
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Comamonadaceae: N E > Delftia: N E > Delftia sp. AN3: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : DQ661649, AB266144
2 UniProt : Q0GQT7, C6KW67
2 UniProt : Q0GQT7, C6KW67
2 Interpro : Q0GQT7, C6KW67
2 Prodom : Q0GQT7, C6KW67
2 Pfam : Q0GQT7, C6KW67
2 PIRSF : Q0GQT7, C6KW67
2 SUPERFAM : Q0GQT7, C6KW67
Sequence
Graphical view for this peptide sequence: 9burk-q0gqt7
Colored MSA for Carbon-carbon_bond_hydrolase (raw)
MNAPHNPEIALSVRTGSFNTNVHDLGSSKPGQPPVLFIHGSGPGVSAWAN
WRLAMPVIAKDRRVIAPDMVGFGYTDRPAGMTYNMDTWVQQALDVMDAMG
VEKADVVGNSFGGALSLALAIRAPQRVRRLVLMGSVGVPFPITPGLDAVW
GYEPSLATMKRLLDIFAHSRALVTDELAELRYQASIRPGFQESFSAMFPA
PRQRWVDAMASPESAIRALPHETLIVHGREDQVIPLQTSLTLSQWIPNSQ
LHVFGHCGHWTQIEHAARFAQLVSNFLAEADAQGAASA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNAPHNPEIALSVRTGSFNTNVHDLGSSKPGQPPVLFIHGSGPGVSAWAN
WRLAMPVIAKDRRVIAPDMVGFGYTDRPAGMTYNMDTWVQQALDVMDAMG
VEKADVVGNSFGGALSLALAIRAPQRVRRLVLMGSVGVPFPITPGLDAVW
GYEPSLATMKRLLDIFAHSRALVTDELAELRYQASIRPGFQESFSAMFPA
PRQRWVDAMASPESAIRALPHETLIVHGREDQVIPLQTSLTLSQWIPNSQ
LHVFGHCGHWTQIEHAARFAQLVSNFLAEADAQGAASA


References
    Title: Novel organization of aromatic degradation pathway genes in a microbial community as revealed by metagenomic analysis
    Suenaga H, Koyama Y, Miyakoshi M, Miyazaki R, Yano H, Sota M, Ohtsubo Y, Tsuda M, Miyazaki K
    Ref: Isme J, 3:1335, 2009 : PubMed

            

    Title: Functional screening of a metagenomic library for genes involved in microbial degradation of aromatic compounds
    Suenaga H, Ohnuki T, Miyazaki K
    Ref: Environ Microbiol, 9:2289, 2007 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer