Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9burk-q3f9v9

Burkholderia ambifaria AMMD thioesterase

Relationship
Family|Thioesterase
Block| X
Position in NCBI Life Tree|Burkholderia ambifaria AMMD
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > Betaproteobacteria: N E > Burkholderiales: N E > Burkholderiaceae: N E > Burkholderia: N E > Burkholderia cepacia complex: N E > Burkholderia ambifaria: N E > Burkholderia ambifaria AMMD: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
3 Genbank : AAJL01000006, WP_041491788, ABI91600
1 UniProt : Q0B2M3
1 UniProt : Q0B2M3
1 Interpro : Q0B2M3
1 Prodom : Q0B2M3
1 Pfam : Q0B2M3
1 PIRSF : Q0B2M3
1 SUPERFAM : Q0B2M3
Sequence
Graphical view for this peptide sequence: 9burk-q3f9v9
Colored MSA for Thioesterase (raw)
MRKERACSICRSCARRCVRSGIAWRGISCRPLPRAWKRCGKRGGIPARLP
DVRVRRVAGACSTDEPDLPTTTLMTPTAALKVFMPVRAPRIRLVCCSYAG
GNASAYAHWHAGLPDDVEVCAVELPGRGARFREPPLRTMGALADHVMASL
LPLADAGIVLFGHSMGGALALELASRLVDVGMPPSALAVSGCAAPHLPSR
RRRRLHDLPRDELVQELNLLEGLPAGMLDADAFIDLFLPTIRADLECRET
WRAAIRAVPVPVHVLAGADDALVALDDLGEWQRYSSLPIRVRVFGGEHFF
IDSHRAEVLAHLREILGEPPAPAGGGAVKRASASTAERIA
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRKERACSICRSCARRCVRSGIAWRGISCRPLPRAWKRCGKRGGIPARLP
DVRVRRVAGACSTDEPDLPTTTLMTPTAALKVFMPVRAPRIRLVCCSYAG
GNASAYAHWHAGLPDDVEVCAVELPGRGARFREPPLRTMGALADHVMASL
LPLADAGIVLFGHSMGGALALELASRLVDVGMPPSALAVSGCAAPHLPSR
RRRRLHDLPRDELVQELNLLEGLPAGMLDADAFIDLFLPTIRADLECRET
WRAAIRAVPVPVHVLAGADDALVALDDLGEWQRYSSLPIRVRVFGGEHFF
IDSHRAEVLAHLREILGEPPAPAGGGAVKRASASTAERIA



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer