Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9chlb-q3vnm5

Pelodictyon phaeoclathratiforme BU-1 similar to esterase/lipase precursor

Relationship
Family|AlphaBeta_hydrolase
Block| X
Position in NCBI Life Tree|Pelodictyon phaeoclathratiforme BU-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Chlorobi: N E > Chlorobia: N E > Chlorobiales: N E > Chlorobiaceae: N E > Chlorobium/Pelodictyon group: N E > Pelodictyon: N E > Pelodictyon phaeoclathratiforme: N E > Pelodictyon phaeoclathratiforme BU-1: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : AAIK01000005, ACF45001
1 UniProt : B4SH13
1 Interpro : B4SH13
1 Pfam : B4SH13
1 PIRSF : B4SH13
1 SUPERFAM : B4SH13
Sequence
Graphical view for this peptide sequence: 9chlb-q3vnm5
Colored MSA for AlphaBeta_hydrolase (raw)
MKYLFCIGSVFYLDEFLKNSQFKGIFPIPHYIQREPFYNLYSQIVSESIM
ELQHRERSPFGVLIIHGFTATLDSVKSLYTSIEKLGIPVRQPLLAGHGAL
SPEALRGVRWESWMADAEQALFELSLEVEQVIVIGHSMGALLSLNLAARH
KEKIDSLVLVAPAIQLISVLAPGRPLHFAAPFVSKIIKNWKLKSDFADQG
CATCIPHYSWVPTDAIISFFELIKISQQLLGRVNVPVLIVHNRRENTVRP
ESALILYNRIATEPSGKSIIWLEHSGHQIFCDCENEKAVKAIMDYVASRI
RQRVHG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKYLFCIGSVFYLDEFLKNSQFKGIFPIPHYIQREPFYNLYSQIVSESIM
ELQHRERSPFGVLIIHGFTATLDSVKSLYTSIEKLGIPVRQPLLAGHGAL
SPEALRGVRWESWMADAEQALFELSLEVEQVIVIGHSMGALLSLNLAARH
KEKIDSLVLVAPAIQLISVLAPGRPLHFAAPFVSKIIKNWKLKSDFADQG
CATCIPHYSWVPTDAIISFFELIKISQQLLGRVNVPVLIVHNRRENTVRP
ESALILYNRIATEPSGKSIIWLEHSGHQIFCDCENEKAVKAIMDYVASRI
RQRVHG



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer