Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9chlb-q43eh9

Chlorobium phaeobacteroides DSM 266 prolyl oligopeptidase precursor (EC 3.4.21.26)

Relationship
Family|S9N_PPCE_Peptidase_S9
Block| X
Position in NCBI Life Tree|Chlorobium phaeobacteroides DSM 266
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > FCB group: N E > Bacteroidetes/Chlorobi group: N E > Chlorobi: N E > Chlorobia: N E > Chlorobiales: N E > Chlorobiaceae: N E > Chlorobium/Pelodictyon group: N E > Chlorobium: N E > Chlorobium phaeobacteroides: N E > Chlorobium phaeobacteroides DSM 266: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : WP_011744884, ABL65057
1 UniProt : A1BF80
1 Interpro : A1BF80
1 Pfam : A1BF80
1 PIRSF : A1BF80
1 SUPERFAM : A1BF80
Sequence
Graphical view for this peptide sequence: 9chlb-q43eh9
Colored MSA for S9N_PPCE_Peptidase_S9 (raw)
MTIPRTALFLLCFLALTSAAFAVEKPEPVVIRKSFPEAQKPVVETWCGET
IADPFRAMENIRNPQVINWLKQESDYARNTLQRIPGRDSLISKMQEFDKR
KVSKVYNLSITENDVYFYLKQTPSDETGQLYYRKGFHGKETLLFNPSSSP
DKESHTVIGTISPSFDGSKVAFTISKNGSEDAVLLIMDVATKKLFPEKIT
RCRFASPSWLKTGDAFLYNRLRALEKPGENPQHNSKTFLHIPGTDPSRDL
EIFSSATNPELVLNPEDIPEVSYEKESGQLFAFLSNVDRRLTVYYAPLDQ
PGKKKTAWKKLFIPKDDVHDFAVTEKDIYFSSPKKASGFRLLKTSLEHPD
LEHAELIVPETPGATLTGFTLTSRGIFYTQSKNGVEEKLYHQEYGKTESK
EIILPSAAGTIALSSKGFRYPDLWVVIAGWSKDYRRYRYDSRNEGTFSLE
TLSSPALYPEYERLKVEELMIPSHDGVMVPLSIVYRNDLDKKGTNPVLLY
GYGAYGNALTPFFSPSLLLWTHKGGILAIVHARGGGELGDAWHTSGMKTT
KPNTWKDLISSAEYLIKEKYSSSRHIAINGASAGGILVGKAMTERPDLFA
AAIPQVGLMNPLRGEETPNGPVNVPEFGTVKKPDECKALIAMDPYLSIID
GVRYPAALVTAGINDPRVSAWQPAKFAARLQAATASNKPVLLFTDFKAGH
GMGNTKQMEFESLADVLSFGLWQTGHPEFQIR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTIPRTALFLLCFLALTSAAFAVEKPEPVVIRKSFPEAQKPVVETWCGET
IADPFRAMENIRNPQVINWLKQESDYARNTLQRIPGRDSLISKMQEFDKR
KVSKVYNLSITENDVYFYLKQTPSDETGQLYYRKGFHGKETLLFNPSSSP
DKESHTVIGTISPSFDGSKVAFTISKNGSEDAVLLIMDVATKKLFPEKIT
RCRFASPSWLKTGDAFLYNRLRALEKPGENPQHNSKTFLHIPGTDPSRDL
EIFSSATNPELVLNPEDIPEVSYEKESGQLFAFLSNVDRRLTVYYAPLDQ
PGKKKTAWKKLFIPKDDVHDFAVTEKDIYFSSPKKASGFRLLKTSLEHPD
LEHAELIVPETPGATLTGFTLTSRGIFYTQSKNGVEEKLYHQEYGKTESK
EIILPSAAGTIALSSKGFRYPDLWVVIAGWSKDYRRYRYDSRNEGTFSLE
TLSSPALYPEYERLKVEELMIPSHDGVMVPLSIVYRNDLDKKGTNPVLLY
GYGAYGNALTPFFSPSLLLWTHKGGILAIVHARGGGELGDAWHTSGMKTT
KPNTWKDLISSAEYLIKEKYSSSRHIAINGASAGGILVGKAMTERPDLFA
AAIPQVGLMNPLRGEETPNGPVNVPEFGTVKKPDECKALIAMDPYLSIID
GVRYPAALVTAGINDPRVSAWQPAKFAARLQAATASNKPVLLFTDFKAGH
GMGNTKQMEFESLADVLSFGLWQTGHPEFQIR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer