Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9chro-a3it90

Cyanothece sp. CCY0110 Putative uncharacterized protein

Relationship
Family|Duf_1400
Block| X
Position in NCBI Life Tree|Cyanothece sp. CCY0110
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Cyanothecaceae: N E > Cyanothece: N E > Cyanothece sp. CCY0110: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acid identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AAXW01000027
1 UniProt : A3IT90
1 UniProt : A3IT90
1 Interpro : A3IT90
1 Pfam : A3IT90
1 PIRSF : A3IT90
1 SUPERFAM : A3IT90
Sequence
Graphical view for this peptide sequence: 9chro-a3it90
Colored MSA for Duf_1400 (raw)
MPRWKLQKKLKTLLFISSLLLGTTLTFKVTAAEEITFYYGSFAQTVDVES
LKIFAENGTVNPDLRTIFNIVKPNEVVKNKFQQALVTPIDINASLLSRLL
NTDEGDRILSELSTLIEMQGGTSGKSVLRGSMIQAAASDDGFTILNFLQT
LPRNMQINVRETLRWAQQASFLVKATENLVKTTENLALKVSDSQPITDFS
QLANLGETGSVSFVRDRWNLTDNERKRRFYVEVYRPQLSASEEIPVIVFS
HGLGERPETYQKMGELLASHGFLVVMPQHPGSDTEYKKDLAEGFTRNIFS
LNEFINRPLDLSYTLDELEKRNETEFDGQLNLEKVGAFGHSFGGYTALAV
AGATLDLQHLQKDCDSSASRFNQAILLQCRALKLQQPIPKLKDERISAVL
VYNPVNASIFGPEGLANVKVPVFVGAGTYDLTTPFVFEQVRSFPWLVNAP
ESYLLIQQGDSHVPLAKLGAGSYFTATSLLKLTLPHDQLRHYYAAPSIVA
FAQVYLADQENYRVYLHPSYITYLSEQEEFKAFLITEESAPSLVESFQQQ
VEGFRNL
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MPRWKLQKKLKTLLFISSLLLGTTLTFKVTAAEEITFYYGSFAQTVDVES
LKIFAENGTVNPDLRTIFNIVKPNEVVKNKFQQALVTPIDINASLLSRLL
NTDEGDRILSELSTLIEMQGGTSGKSVLRGSMIQAAASDDGFTILNFLQT
LPRNMQINVRETLRWAQQASFLVKATENLVKTTENLALKVSDSQPITDFS
QLANLGETGSVSFVRDRWNLTDNERKRRFYVEVYRPQLSASEEIPVIVFS
HGLGERPETYQKMGELLASHGFLVVMPQHPGSDTEYKKDLAEGFTRNIFS
LNEFINRPLDLSYTLDELEKRNETEFDGQLNLEKVGAFGHSFGGYTALAV
AGATLDLQHLQKDCDSSASRFNQAILLQCRALKLQQPIPKLKDERISAVL
VYNPVNASIFGPEGLANVKVPVFVGAGTYDLTTPFVFEQVRSFPWLVNAP
ESYLLIQQGDSHVPLAKLGAGSYFTATSLLKLTLPHDQLRHYYAAPSIVA
FAQVYLADQENYRVYLHPSYITYLSEQEEFKAFLITEESAPSLVESFQQQ
VEGFRNL



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer