Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cnid-a0a3m6v1j0

Pocillopora damicornis. Hydrolase_4 domain-containing protein

Relationship
Family|abh_upf0017
Block| X
Position in NCBI Life Tree|Pocillopora damicornis
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Cnidaria: N E > Anthozoa: N E > Hexacorallia: N E > Scleractinia: N E > Astrocoeniina: N E > Pocilloporidae: N E > Pocillopora: N E > Pocillopora damicornis: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : RCHS01000299
1 UniProt : A0A3M6V1J0
1 UniProt : A0A3M6V1J0
1 Interpro : A0A3M6V1J0
1 Pfam : A0A3M6V1J0
1 PIRSF : A0A3M6V1J0
1 SUPERFAM : A0A3M6V1J0
Sequence
Graphical view for this peptide sequence: 9cnid-a0a3m6v1j0
Colored MSA for abh_upf0017 (raw)
MADKGVIALDWMEVDETAMKKVSPVMLLIPDLTGVAANMAAVCTEVLARN
FRPVVFNRRGHCSTALSTYRLQSFGDARDLEEAIQFIHHMYPYSEIFAIG
FSTGSGLLMSYLGEVGNASQLNAAVCISPCYDAEGLFKSNNVPEPYNWLW
TFKLKCVLRQHPCLGNVINYNLALQSSSIKELDERVYVKLNQYNSLAEYW
KYNDPMRSITNIHIPVLCISALDDPICTKDTIPFSLFKTSSNLFLVTTEK
GGHCGFLENGLPTSWANKLACDYLETVYHQGIPKQPEENHIHFFPEFNGT
RNRSYTT
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MADKGVIALDWMEVDETAMKKVSPVMLLIPDLTGVAANMAAVCTEVLARN
FRPVVFNRRGHCSTALSTYRLQSFGDARDLEEAIQFIHHMYPYSEIFAIG
FSTGSGLLMSYLGEVGNASQLNAAVCISPCYDAEGLFKSNNVPEPYNWLW
TFKLKCVLRQHPCLGNVINYNLALQSSSIKELDERVYVKLNQYNSLAEYW
KYNDPMRSITNIHIPVLCISALDDPICTKDTIPFSLFKTSSNLFLVTTEK
GGHCGFLENGLPTSWANKLACDYLETVYHQGIPKQPEENHIHFFPEFNGT
RNRSYTT


Reference
    Title: Comparative analysis of the Pocillopora damicornis genome highlights role of immune system in coral evolution
    Cunning R, Bay RA, Gillette P, Baker AC, Traylor-Knowles N
    Ref: Sci Rep, 8:16134, 2018 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer