Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cnid-b7zf10

Clytia hemisphaerica Carboxylesterase 3

Relationship
Family|Carb_B_Root
Block| C
Position in NCBI Life Tree|Clytia hemisphaerica
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Eukaryota: N E > Opisthokonta: N E > Metazoa: N E > Eumetazoa: N E > Cnidaria: N E > Hydrozoa: N E > Hydroidolina: N E > Leptothecata: N E > Campanulariidae: N E > Clytia: N E > Clytia hemisphaerica: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : AM902712
1 UniProt : B7ZF10
1 UniProt : B7ZF10
1 Interpro : B7ZF10
1 Pfam : B7ZF10
1 PIRSF : B7ZF10
1 SUPERFAM : B7ZF10
Sequence
Graphical view for this peptide sequence: 9cnid-b7zf10
Colored MSA for Carb_B_Root (raw)
RSTKLSKKMKVKLQRKLLLFTILCVHITSTFAVPQNRIPDADRDYVNIDT
ECGPVEGKRFTENVKWHNDSVNVYEFRNIPYAKPPVGKLRWRPPVRLSDD
PAQCWDGVLKYNKNVVACKQDHPFTPSVNTSEDCLVLTVRTPNLDPSSKL
PVIVWIHGGGMLWGYNEMFAFHPDTEFSAYMEAVTVSINYRLNVFGFMSL
KELWIENGPNKSYGNYGILDQIETLKWVKSNIKQFGGDSENVMIYGESGG
GTGVYCLLCSPLANGLFQKASPQSGAPNIRTTHEVADMKYRSIIDKADCQ
KESPDNIVECLQNIDADDFLSLFKGTSVTPYHWKMPTNEPYNGYPVEILD
PVVVTKSPDQIPVHQNTQVELLIGNCAQETGPFPHKPKPDANITTWADLQ
AALEPQMDTFKKGHYPHFLDQYQNDLKSPPQNITPKYVYEVMTSDALVLC
TTNYVADHLSKVKGYTVSRYVMSQPPTKEIGLGLETAYHGWDSVLLFGLK
FYKR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

RSTKLSKKMKVKLQRKLLLFTILCVHITSTFAVPQNRIPDADRDYVNIDT
ECGPVEGKRFTENVKWHNDSVNVYEFRNIPYAKPPVGKLRWRPPVRLSDD
PAQCWDGVLKYNKNVVACKQDHPFTPSVNTSEDCLVLTVRTPNLDPSSKL
PVIVWIHGGGMLWGYNEMFAFHPDTEFSAYMEAVTVSINYRLNVFGFMSL
KELWIENGPNKSYGNYGILDQIETLKWVKSNIKQFGGDSENVMIYGESGG
GTGVYCLLCSPLANGLFQKASPQSGAPNIRTTHEVADMKYRSIIDKADCQ
KESPDNIVECLQNIDADDFLSLFKGTSVTPYHWKMPTNEPYNGYPVEILD
PVVVTKSPDQIPVHQNTQVELLIGNCAQETGPFPHKPKPDANITTWADLQ
AALEPQMDTFKKGHYPHFLDQYQNDLKSPPQNITPKYVYEVMTSDALVLC
TTNYVADHLSKVKGYTVSRYVMSQPPTKEIGLGLETAYHGWDSVLLFGLK
FYKR


References
    Title: The genome of the jellyfish Clytia hemisphaerica and the evolution of the cnidarian life-cycle
    Leclere L, Horin C, Chevalier S, Lapebie P, Dru P, Peron S, Jager M, Condamine T, Pottin K and Copley RR <16 more author(s)>
    Ref: Nat Ecol Evol, 3:801, 2019 : PubMed

            

    Title: Acetylcholinesterase activity in Clytia hemisphaerica (Cnidaria)
    Denker E, Chatonnet A, Rabet N
    Ref: Chemico-Biological Interactions, 175:125, 2008 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer