Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cory-c2gdp1

Corynebacterium glucuronolyticum (strains ATCC 51866 ATCC 51867) Trehalose corynomycolyl transferase C

Comment
only n-term Pfam A Esterase 49 319


Relationship
Family|A85-Mycolyl-transferase
Block| X
Position in NCBI Life Tree|Corynebacterium glucuronolyticum
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium glucuronolyticum: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ACHF01000004, ABYP01000090
1 UniProt : C2GDP1
1 UniProt : C2GDP1
1 Interpro : C2GDP1
1 Prodom : C2GDP1
1 Pfam : C2GDP1
1 PIRSF : C2GDP1
1 SUPERFAM : C2GDP1
Sequence
Graphical view for this peptide sequence: 9cory-c2gdp1
Colored MSA for A85-Mycolyl-transferase (raw)
MSSRLRYLAYPLALSLLITPVAGAQSSFPSVPNQPGLSDYLQDDVPQRTP
IRTDYPEIKGLPDGVSVDRVEWITDRRIAVFIKSAAMPGEPVQVQMLLAR
DWYSNPAKSYPEVWALDGLRALDTENGWTINTNIEQMFADKNVNVILPVG
GESSFYSDWLKENNGKNYKWETFLTQELPAVLKQGYRSNGQRAITGISMG
GTAAMNLAQHRPDMFNFVGSFSGYLDTTSPGMPLAIRGALSDAGGYDATA
MWGPDGSQQWIDHDPKLGLDALKGKTVYVSSGSGKDDFGEPGSVATGPAN
PAGIGLEVVSRMTTQTFVDRANRAGLEVISQFRGSGVHAWPYWQFEMVQA
WPYIAD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MSSRLRYLAYPLALSLLITPVAGAQSSFPSVPNQPGLSDYLQDDVPQRTP
IRTDYPEIKGLPDGVSVDRVEWITDRRIAVFIKSAAMPGEPVQVQMLLAR
DWYSNPAKSYPEVWALDGLRALDTENGWTINTNIEQMFADKNVNVILPVG
GESSFYSDWLKENNGKNYKWETFLTQELPAVLKQGYRSNGQRAITGISMG
GTAAMNLAQHRPDMFNFVGSFSGYLDTTSPGMPLAIRGALSDAGGYDATA
MWGPDGSQQWIDHDPKLGLDALKGKTVYVSSGSGKDDFGEPGSVATGPAN
PAGIGLEVVSRMTTQTFVDRANRAGLEVISQFRGSGVHAWPYWQFEMVQA
WPYIAD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer