Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cory-e0ded5

Corynebacterium matruchotii ATCC 14266 Cutinase

Comment
Other strains: Corynebacterium matruchotii (ATCC 14266; ATCC 33806) Cutinase


Relationship
Family|Cutinase
Block| X
Position in NCBI Life Tree|Corynebacterium matruchotii ATCC 14266
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Actinobacteria [phylum]: N E > Actinobacteria [class]: N E > Corynebacteriales: N E > Corynebacteriaceae: N E > Corynebacterium: N E > Corynebacterium matruchotii: N E > Corynebacterium matruchotii ATCC 14266: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ACSH02000004, ACEB01000038
2 UniProt : E0DED5, C0E5Y2
2 UniProt : E0DED5, C0E5Y2
2 Interpro : E0DED5, C0E5Y2
2 Pfam : E0DED5, C0E5Y2
2 PIRSF : E0DED5, C0E5Y2
2 SUPERFAM : E0DED5, C0E5Y2
Sequence
Graphical view for this peptide sequence: 9cory-e0ded5
Colored MSA for Cutinase (raw)
MKKVLTVLAALVVIVVVAAGAQQWLSQTNKGGPVGPPETSEATMVTQPDH
CPRVEVLVAPGTWESSKTDDPFNPTANPKSFMLNISRPLQEAYPAHEVKV
WTLPYTAQFKNINSQNEMPYDESREEGIATMETEMRDVFRECPLTDYILT
GFSQGAVIAGDIANKIGTGTGVVPAERIRGVALIADGRREPNVGQHVGNP
VGGVGAEIALQPLNLLVQPVVPGATMRGPRQGGFGALNDRTFEICAPNDA
ICDAPREIGNALGRATEMVQANGVHSVYATNPYVIPDTTANQWVVEWAKG
LINR
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MKKVLTVLAALVVIVVVAAGAQQWLSQTNKGGPVGPPETSEATMVTQPDH
CPRVEVLVAPGTWESSKTDDPFNPTANPKSFMLNISRPLQEAYPAHEVKV
WTLPYTAQFKNINSQNEMPYDESREEGIATMETEMRDVFRECPLTDYILT
GFSQGAVIAGDIANKIGTGTGVVPAERIRGVALIADGRREPNVGQHVGNP
VGGVGAEIALQPLNLLVQPVVPGATMRGPRQGGFGALNDRTFEICAPNDA
ICDAPREIGNALGRATEMVQANGVHSVYATNPYVIPDTTANQWVVEWAKG
LINR



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer