(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Terrabacteria group: NE > Cyanobacteria/Melainabacteria group: NE > Cyanobacteria: NE > Oscillatoriophycideae: NE > Oscillatoriales: NE > Microcoleaceae: NE > Kamptonema: NE > [Oscillatoria] sp. PCC 6506: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MTQEDYCNYIYLHGFASSPQSAKAEYLSDRFFELGINLKLPDLNQGDFSH LTLTRQLQQVEAEFRQLEKSQLSVDKGKIGLIGSSFGGLTAAILAQQNIE VQRIILLAPAFGFLSHWLPKLGDEQLAKWQSEGYLSVYHYGKNQYLPLHY QFAIDIAQYRDEDLQRPVPTLIFHGKDDEVIPIQSSRDFADQRPWVQLIE LNSDHALTNVLPEIWEEMQNFCQFKVKI
Reference
Title: The genome sequence of the cyanobacterium Oscillatoria sp. PCC 6506 reveals several gene clusters responsible for the biosynthesis of toxins and secondary metabolites Mejean A, Mazmouz R, Mann S, Calteau A, Medigue C, Ploux O Ref: Journal of Bacteriology, 192:5264, 2010 : PubMed
We report a draft sequence of the genome of Oscillatoria sp. PCC 6506, a cyanobacterium that produces anatoxin-a and homoanatoxin-a, two neurotoxins, and cylindrospermopsin, a cytotoxin. Beside the clusters of genes responsible for the biosynthesis of these toxins, we have found other clusters of genes likely involved in the biosynthesis of not-yet-identified secondary metabolites.