Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9cyan-f4xvi1

Moorea producta 3L Putative hydrolase/acyltransferase, alpha/beta hydrolase superfamily

Relationship
Family|MenH_SHCHC
Block| X
Position in NCBI Life Tree|Moorea producta 3L
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Cyanobacteria/Melainabacteria group: N E > Cyanobacteria: N E > Oscillatoriophycideae: N E > Oscillatoriales: N E > Oscillatoriaceae: N E > Moorea: N E > Moorea producens: N E > Moorea producens 3L: N E
Warning: This entry is a compilation of different species or line or strain with more than 90% amino acide identity. You can retrieve all strain data


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
1 Genbank : GL890940
1 UniProt : F4XVI1
1 UniProt : F4XVI1
1 Interpro : F4XVI1
1 Pfam : F4XVI1
1 PIRSF : F4XVI1
1 SUPERFAM : F4XVI1
Sequence
Graphical view for this peptide sequence: 9cyan-f4xvi1
Colored MSA for MenH_SHCHC (raw)
MLYKFHYELRGNREQPRILFCHGFMGSSQEFDEAISLLCEEFCCLAVDLP
GHGKTKVLGGDECYTMPNTAHALKELLEQLNFEPCFLVGYSMGGRLALYM
TLHFPECFSKVVLESASPGLKTQAEQLKRRQRDLQIAEKLETGDLLTFLS
NWYNQPLFSSLKQHPKFEQMIKIRQQNNPLELAKSLRHISTGCQPSLWES
LQHNQVPLLLLVGEYDHKFKSINSEIVTLCTEANLNVIADCGHNIHFENV
NEFVKNVRQFF
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MLYKFHYELRGNREQPRILFCHGFMGSSQEFDEAISLLCEEFCCLAVDLP
GHGKTKVLGGDECYTMPNTAHALKELLEQLNFEPCFLVGYSMGGRLALYM
TLHFPECFSKVVLESASPGLKTQAEQLKRRQRDLQIAEKLETGDLLTFLS
NWYNQPLFSSLKQHPKFEQMIKIRQQNNPLELAKSLRHISTGCQPSLWES
LQHNQVPLLLLVGEYDHKFKSINSEIVTLCTEANLNVIADCGHNIHFENV
NEFVKNVRQFF


Reference
    Title: Genomic insights into the physiology and ecology of the marine filamentous cyanobacterium Lyngbya majuscula
    Jones AC, Monroe EA, Podell S, Hess WR, Klages S, Esquenazi E, Niessen S, Hoover H, Rothmann M and Gerwick L <8 more author(s)>
    Ref: Proc Natl Acad Sci U S A, 108:8815, 2011 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer