Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9delt-EstD11

Uncultured Deltaproteobacteria bacterium thermophilic esterase EstD11

Relationship
Family|Hormone-sensitive_lipase_like
Block| H
Position in NCBI Life Tree|Deltaproteobacteria bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > unclassified Deltaproteobacteria: N E > unclassified Deltaproteobacteria (miscellaneous): N E > Deltaproteobacteria bacterium: N E


Molecular evidence
Database
No mutation
10 structures (e.g. : 7AT0, 7AT2, 7AT3... more)
No kinetic





5 substrates (e.g. : Fluorescein-diacetate, Naproxen, Naproxen-Methyl-Ester... more)
No inhibitor
1 Genbank : HEO46722
>3 Structure links 7 more: 7ATD, 7ATF, 7AT3
Sequence
Graphical view for this peptide sequence: 9delt-EstD11
Colored MSA for Hormone-sensitive_lipase_like (raw)
MASEALTMIVNLLRSQRPLQEPTVEQMRAGLEAMAQMSPLPADVELTTVD
AGGVPGAWVRVPESDPDRVVLYLHGGGYVIGSIRTHRDLAQRIARAARCR
VLLIDYRLAPEHPHPAAVEDSTRAYRWLLETGSDPKRMAIAGDAAGGGLT
VATLVALRDAGVPLPAAAVCLSPWVDLEGIGESMTTKAAVDPMVQREPLL
RMASMYLAGQDPRTPLAAPLYADLRGLPPLLIQVGTAETLLDDSVRLAER
ARAAGVQVTLEPWEDMIHVWQAFAAMLPEGQQAIERIGEFLRQHWQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MASEALTMIVNLLRSQRPLQEPTVEQMRAGLEAMAQMSPLPADVELTTVD
AGGVPGAWVRVPESDPDRVVLYLHGGGYVIGSIRTHRDLAQRIARAARCR
VLLIDYRLAPEHPHPAAVEDSTRAYRWLLETGSDPKRMAIAGDAAGGGLT
VATLVALRDAGVPLPAAAVCLSPWVDLEGIGESMTTKAAVDPMVQREPLL
RMASMYLAGQDPRTPLAAPLYADLRGLPPLLIQVGTAETLLDDSVRLAER
ARAAGVQVTLEPWEDMIHVWQAFAAMLPEGQQAIERIGEFLRQHWQ


Reference
    Title: Biochemical and Structural Characterization of a novel thermophilic esterase EstD11 provide catalytic insights for the HSL family
    Miguel-Ruano V, Rivera I, Rajkovic J, Knapik K, Torrado A, Otero JM, Beneventi E, Becerra M, Sanchez-Costa M and Hermoso JA <5 more author(s)>
    Ref: Comput Struct Biotechnol J, 19:1214, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer