Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9delt-a6g7b1

Plesiocystis pacifica SIR-1 Haloalkane dehalogenase, putative

Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Plesiocystis pacifica SIR-1
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Proteobacteria: N E > delta/epsilon subdivisions: N E > Deltaproteobacteria: N E > Myxococcales: N E > Nannocystineae: N E > Nannocystaceae: N E > Plesiocystis: N E > Plesiocystis pacifica: N E > Plesiocystis pacifica SIR-1: N E


Molecular evidence
Database
No mutation
1 structure:
2XT0: Dehalogenase DPpA from Plesiocystis pacifica SIR-I
No kinetic





No Substrate
No inhibitor
1 Genbank : ABCS01000033
1 UniProt : A6G7B1
1 Structure : 2XT0
1 UniProt : A6G7B1
1 Interpro : A6G7B1
1 Prodom : A6G7B1
1 Pfam : A6G7B1
1 PIRSF : A6G7B1
1 SUPERFAM : A6G7B1
Sequence
Graphical view for this peptide sequence: 9delt-a6g7b1
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MEFVRTPDDRFADLPDFPYAPHYLEGLPGFEGLRMHYVDEGPRDAEHTFL
CLHGEPSWSFLYRKMLPVFTAAGGRVVAPDLFGFGRSDKPTDDAVYTFGF
HRRSLLAFLDALQLERVTLVCQDWGGILGLTLPVDRPQLVDRLIVMNTAL
AVGLSPGKGFESWRDFVANSPDLDVGKLMQRAIPGITDAEVAAYDAPFPG
PEFKAGVRRFPAIVPITPDMEGAEIGRQAMSFWSTQWSGPTFMAVGPQDP
VLGPEVMGMLRQAIGGCPEPMIVEAGGHFVQEHGEPIARAALAAFGQ
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MEFVRTPDDRFADLPDFPYAPHYLEGLPGFEGLRMHYVDEGPRDAEHTFL
CLHGEPSWSFLYRKMLPVFTAAGGRVVAPDLFGFGRSDKPTDDAVYTFGF
HRRSLLAFLDALQLERVTLVCQDWGGILGLTLPVDRPQLVDRLIVMNTAL
AVGLSPGKGFESWRDFVANSPDLDVGKLMQRAIPGITDAEVAAYDAPFPG
PEFKAGVRRFPAIVPITPDMEGAEIGRQAMSFWSTQWSGPTFMAVGPQDP
VLGPEVMGMLRQAIGGCPEPMIVEAGGHFVQEHGEPIARAALAAFGQ


References
    Title: Cloning, functional expression, biochemical characterization, and structural analysis of a haloalkane dehalogenase from Plesiocystis pacifica SIR-1
    Hesseler M, Bogdanovic X, Hidalgo A, Berenguer J, Palm GJ, Hinrichs W, Bornscheuer UT
    Ref: Applied Microbiology & Biotechnology, 91:1049, 2011 : PubMed

            

    Title: Crystallization and preliminary X-ray diffraction studies of the putative haloalkane dehalogenase DppA from Plesiocystis pacifica SIR-I
    Bogdanovic X, Hesseler M, Palm GJ, Bornscheuer UT, Hinrichs W
    Ref: Acta Crystallographica Sect F Struct Biol Cryst Commun, 66:828, 2010 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer