(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.) > cellular organisms: NE > Bacteria: NE > Proteobacteria: NE > Gammaproteobacteria: NE > Enterobacterales: NE > Yersiniaceae: NE > Serratia: NE > Serratia sp. M24T3: NE
LegendThis sequence has been compared to family alignement (MSA) red => minority aminoacid blue => majority aminoacid color intensity => conservation rate title => sequence position(MSA position)aminoacid rate Catalytic site Catalytic site in the MSA MSTLLYLHGFNSSPHSAKATAMKNWLAEHHPHIEMLVPQLLPFPADAAEQ LEKLVMDKSGERIGIVGSSLGGFYATWLSQCFTLPAVVVNPAVRPYELLI DYLGVNHNPYTGQQYVLESRHVYDLKVMQIEPLESPDLLWLLQQTGDETL DYRQALSYYTSCRQTVEPEGNHAFVGFERYFSPIVDFLGLAAE
Here we report the draft genome sequence of Serratia sp. strain M24T3, which is associated with pinewood nematode Bursaphelenchus xylophilus, the causative agent of pine wilt disease. Serratia sp. strain M24T3 has been identified as a bionematocide for B. xylophilus in vitro, and multiple genes potentially involved in virulence and nematotoxity were identified.