Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9eury-6QE2

Palaeococcus ferrophilus monoacylglycerol lipase

Relationship
Family|Monoglyceridelipase_lysophospholip
Block| X
Position in NCBI Life Tree|Palaeococcus ferrophilus
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Thermococci: N E > Thermococcales: N E > Thermococcaceae: N E > Palaeococcus: N E > Palaeococcus ferrophilus: N E


Molecular evidence
Database
No mutation
1 structure:
6QE2: Crystal structure of Palaeococcus ferrophilus monoacylglycerol lipase
No kinetic





No Substrate
2 inhibitors: Lauramine-oxide, Methyl-arachidonyl-fluorophosphonate
1 Genbank : WP_048148833
1 UniProt : A0A6I8WFT7
1 Structure : 6QE2
1 UniProt : A0A6I8WFT7
1 Interpro : A0A6I8WFT7
1 Prodom : A0A6I8WFT7
1 Pfam : A0A6I8WFT7
1 PIRSF : A0A6I8WFT7
1 SUPERFAM : A0A6I8WFT7
Sequence
Graphical view for this peptide sequence: 9eury-6QE2
Colored MSA for Monoglyceridelipase_lysophospholip (raw)
MELYRAKFGTPERGWVVLVHGLGEHSGRYGKLIELLNGAGFGVYAFDWPG
HGKSPGKRGHTSVEEAMKIIDSIIEELGEKPFLFGHSLGGLTVIRYAETR
PDKIMGVVASSPALAKSPKTPSFMVALAKVLGRITPGLSLSNGLDPKLLS
RNPDAVKRYIEDPLVHDRISGKLGMSVFDNMERAHKEAERIKAPVLLLVG
TADIITPPEGSRRLFEELKVKDKTIMEFKGAYHEIFEDPEWGEEFHRAIV
EWLVSHSRGDLEWASAERASSIMGD
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MELYRAKFGTPERGWVVLVHGLGEHSGRYGKLIELLNGAGFGVYAFDWPG
HGKSPGKRGHTSVEEAMKIIDSIIEELGEKPFLFGHSLGGLTVIRYAETR
PDKIMGVVASSPALAKSPKTPSFMVALAKVLGRITPGLSLSNGLDPKLLS
RNPDAVKRYIEDPLVHDRISGKLGMSVFDNMERAHKEAERIKAPVLLLVG
TADIITPPEGSRRLFEELKVKDKTIMEFKGAYHEIFEDPEWGEEFHRAIV
EWLVSHSRGDLEWASAERASSIMGD



No Reference

Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer