Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9eury-m0il93

Haloferax mucosum ATCC BAA-1512 Haloalkane dehalogenase HLDIII DhmuA

Relationship
Family|Haloalkane_dehalogenase-HLD1
Block| X
Position in NCBI Life Tree|Haloferax mucosum ATCC BAA-1512
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Archaea: N E > Euryarchaeota: N E > Stenosarchaea group: N E > Halobacteria: N E > Haloferacales: N E > Haloferacaceae: N E > Haloferax: N E


Molecular evidence
Database
No mutation
No structure
No kinetic





No Substrate
No inhibitor
2 Genbank : ELZ96817, WP_008318309
1 UniProt : M0IL93
1 UniProt : M0IL93
1 Interpro : M0IL93
1 Pfam : M0IL93
1 PIRSF : M0IL93
1 SUPERFAM : M0IL93
Sequence
Graphical view for this peptide sequence: 9eury-m0il93
Colored MSA for Haloalkane_dehalogenase-HLD1 (raw)
MTTVSSTERGDAVAALHRDAGWVDRSEFPFESRCLGLSDGAVHYVDEAPD
DGGQASLLMLHGNPTWSFLYRHLVRDLRDEYRCVALDYLGFGLSERPDEF
SYRPADHAAVVEEFIDELGLEDVVLVVQDWGGPIGLSYAIEHPENVSGLV
VMNTWLWPVDDDTHFSRFSKLLGGRVGRELCERYDLFTRLMPLAFADRSK
FSPSAREQYRAANDDDRTGTGVFPQSILGSSAWLSSLWKRRETIADIPAR
LIWGMDDPAFRPAELRTFEALFEDASTARLHGVGHYVQEEFGADLVPLVR
AFLDDLAG
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MTTVSSTERGDAVAALHRDAGWVDRSEFPFESRCLGLSDGAVHYVDEAPD
DGGQASLLMLHGNPTWSFLYRHLVRDLRDEYRCVALDYLGFGLSERPDEF
SYRPADHAAVVEEFIDELGLEDVVLVVQDWGGPIGLSYAIEHPENVSGLV
VMNTWLWPVDDDTHFSRFSKLLGGRVGRELCERYDLFTRLMPLAFADRSK
FSPSAREQYRAANDDDRTGTGVFPQSILGSSAWLSSLWKRRETIADIPAR
LIWGMDDPAFRPAELRTFEALFEDASTARLHGVGHYVQEEFGADLVPLVR
AFLDDLAG


Reference
    Title: Functional and Mechanistic Characterization of an Enzyme Family Combining Bioinformatics and High-Throughput Microfluidics
    Vasina M, Vanacek P, Hon J, Kovar D, Faldynova H, Kunka A, Badenhorst C, Buryska T, Mazurenko S and Prokop Z <5 more author(s)>
    Ref: ResearchSquare, :, 2021 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer