Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-PHL7

Thermoanaerobacterales bacterium Polyester Hydrolase Leipzig 7 (PHL-7) PHL7 PES-H1

Comment
PHL7 PES-H1 PESH-2 are very similar proteins PHL7 and PES-H1 are identical and PES-H2 differs in only four residues (A/E1, L/F209, D/N232, and S/A254), only the L/F209 is close to the catalytic triad. These proteins are not separated here and considered as mutants of the same entry.


Relationship
Family|Polyesterase-lipase-cutinase
Block| L
Position in NCBI Life Tree|Thermoanaerobacterales bacterium
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Clostridia: N E > Thermoanaerobacterales: N E > unclassified Thermoanaerobacterales: N E > Thermoanaerobacterales bacterium: N E


Molecular evidence
Database
No mutation
9 structures (e.g. : 7CUV, 7E30, 7E31... more)
No kinetic





1 substrate:
Polyethylene-terephthalate
2 inhibitors: Citric-acid, MHETA
1 Genbank : MBO2503201
>3 Structure links 6 more: 7W69, 7CUV, 7W6C
Sequence
Graphical view for this peptide sequence: 9firm-PHL7
Colored MSA for Polyesterase-lipase-cutinase (raw)
MRHMSTSIARVRTRLGALLAGVIVAGSTVIGAAPAGAQENPYERGPDPTE
SSIEAVRGPFAVAQTTVSRLQADGFGGGTIYYPTDTSQGTFGAVAISPGF
TAGQESIAWLGPRIASQGFVVITIDTITRLDQPDSRGRQLQAALDHLRTN
SVVRNRIDPNRMAVMGHSMGGGGALSAAANNTSLEAAIPLQGWHTRKNWS
SVRTPTLVVGAQLDTIAPVSSHSEAFYNSLPSDLDKAYMELRGASHLVSN
TPDTTTAKYSIAWLKRFVDDDLRYEQFLCPAPDDFAISEYRSTCPHSGSG
GGTTPPPEDDCPWWAWWC
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MRHMSTSIARVRTRLGALLAGVIVAGSTVIGAAPAGAQENPYERGPDPTE
SSIEAVRGPFAVAQTTVSRLQADGFGGGTIYYPTDTSQGTFGAVAISPGF
TAGQESIAWLGPRIASQGFVVITIDTITRLDQPDSRGRQLQAALDHLRTN
SVVRNRIDPNRMAVMGHSMGGGGALSAAANNTSLEAAIPLQGWHTRKNWS
SVRTPTLVVGAQLDTIAPVSSHSEAFYNSLPSDLDKAYMELRGASHLVSN
TPDTTTAKYSIAWLKRFVDDDLRYEQFLCPAPDDFAISEYRSTCPHSGSG
GGTTPPPEDDCPWWAWWC


References
    Title: Real-Time Noninvasive Analysis of Biocatalytic PET Degradation
    Frank R, Krinke D, Sonnendecker C, Zimmermann W, Jahnke HG
    Ref: ACS Catal, 12:25, 2022 : PubMed

            

    Title: Multiple Substrate Binding Mode-Guided Engineering of a Thermophilic PET Hydrolase
    Pfaff L, Gao J, Li Z, Jackering A, Weber G, Mican J, Chen Y, Dong W, Han X and Wei R <10 more author(s)>
    Ref: ACS Catal, 12:9790, 2022 : PubMed

            

    Title: Low Carbon Footprint Recycling of Post-Consumer PET Plastic with a Metagenomic Polyester Hydrolase
    Sonnendecker C, Oeser J, Richter PK, Hille P, Zhao Z, Fischer C, Lippold H, Blazquez-Sanchez P, Engelberger F and Zimmermann W <9 more author(s)>
    Ref: ChemSusChem, 15:e202101062, 2022 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer