Gene_Locus Report

Biblio print

Add to basket

Go to basket

Tree Display

AceDB Schema

XML Display

Feedback

Gene_locus Report for: 9firm-a0a0a0ymq9

Pelosinus fermentans DSM 17108. Lipase

Relationship
Family|Bacterial_lip_FamI.5
Block| L
Position in NCBI Life Tree|Pelosinus fermentans DSM 17108
(Below N is a link to NCBI taxonomic web page and E link to ESTHER at designed phylum.)
> cellular organisms: N E > Bacteria: N E > Terrabacteria group: N E > Firmicutes: N E > Negativicutes: N E > Selenomonadales: N E > Sporomusaceae: N E > Pelosinus: N E > Pelosinus fermentans: N E > Pelosinus fermentans DSM 17108: N E


Molecular evidence
Database
No mutation
1 structure:
5AH0: Biochemical and Structural Characterization of a PBAT-Hydrolyzing Lipase from Pelosinus fermentans
No kinetic





2 substrates: PBAT, Paranitrophenyl-octanoate
No inhibitor
1 Genbank : KM377649
1 UniProt : A0A0A0YMQ9
1 Structure : 5AH0
1 UniProt : A0A0A0YMQ9
1 Interpro : A0A0A0YMQ9
1 Prodom : A0A0A0YMQ9
1 Pfam : A0A0A0YMQ9
1 PIRSF : A0A0A0YMQ9
1 SUPERFAM : A0A0A0YMQ9
Sequence
Graphical view for this peptide sequence: 9firm-a0a0a0ymq9
Colored MSA for Bacterial_lip_FamI.5 (raw)
MNSYPIVLVHGFMGWGRNEVLGLKYWGGITDYEQELSSYGYTAYTATVGP
VSSNWDRACELYAYIKGGTVDYGHAHSTQKGHSRYGRTYPGLYPEWGNLT
TEGKVNKIHLVAHSMGGQTVRTLVQLLKEGSEEERNTTPSQLSSLFAGGK
SWVHSITTIASPHDGTTLADGINIFGDFAKNLVASLASFTGAGEKLIYDF
KLDQWGLNRKSGESLTDYTNRVFNSAIWNSTNDLANWDLSTDGARVLNQW
VKAQSDIYYFSYSTCATVPSILTSNELPHVIYMTPLLYPFGRFIGSYTRN
EQGRVIIDNSWKPNDGVVNTISQNGPKIWSSDKIVNYNGVPQIGKWNSMP
LLDTIDHMDACGIGTNALTLSWYKGLAEKLSQLTISNLE
Legend This sequence has been compared to family alignement (MSA)
red => minority aminoacid
blue => majority aminoacid
color intensity => conservation rate
title => sequence position(MSA position)aminoacid rate
Catalytic site
Catalytic site in the MSA

MNSYPIVLVHGFMGWGRNEVLGLKYWGGITDYEQELSSYGYTAYTATVGP
VSSNWDRACELYAYIKGGTVDYGHAHSTQKGHSRYGRTYPGLYPEWGNLT
TEGKVNKIHLVAHSMGGQTVRTLVQLLKEGSEEERNTTPSQLSSLFAGGK
SWVHSITTIASPHDGTTLADGINIFGDFAKNLVASLASFTGAGEKLIYDF
KLDQWGLNRKSGESLTDYTNRVFNSAIWNSTNDLANWDLSTDGARVLNQW
VKAQSDIYYFSYSTCATVPSILTSNELPHVIYMTPLLYPFGRFIGSYTRN
EQGRVIIDNSWKPNDGVVNTISQNGPKIWSSDKIVNYNGVPQIGKWNSMP
LLDTIDHMDACGIGTNALTLSWYKGLAEKLSQLTISNLE


Reference
    Title: Characterization of a poly(butylene adipate-co-terephthalate)-hydrolyzing lipase from Pelosinus fermentans
    Biundo A, Hromic A, Pavkov-Keller T, Gruber K, Quartinello F, Haernvall K, Perz V, Arrell MS, Zinn M and Guebitz GM <1 more author(s)>
    Ref: Applied Microbiology & Biotechnology, 100:1753, 2016 : PubMed

            


Other Papers


Send your questions or comments to :
Mail to: Nicolas Lenfant, Thierry Hotelier, Yves Bourne, Pascale Marchot and Arnaud Chatonnet.
Please cite: Lenfant 2013 Nucleic.Acids.Res. or Marchot Chatonnet 2012 Prot.Pept Lett.
For technical information about these pages see:
ESTHER Home Page and ACEDB Home Page
AcePerl Lincoln Stein Home Page
webmaster

Acknowledgements and disclaimer